KEGG   Glaesserella parasuis ZJ0906: K756_10990Help
Entry
K756_10990        CDS       T02697                                 

Gene name
rpsS
Definition
(GenBank) 30S ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz03010  Ribosome
Module
hpaz_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    K756_10990 (rpsS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpaz03011]
    K756_10990 (rpsS)
Ribosome [BR:hpaz03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    K756_10990 (rpsS)
  Archaea
    K756_10990 (rpsS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S19 Oest_recep
Motif
Other DBs
NCBI-GeneID: 16167109
NCBI-ProteinID: AGO17293
Position
2114665..2114940
Genome map
AA seq 91 aa AA seqDB search
MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMIGLTIAVHNGRQHVPV
YVSDEMIGHKLGEFAPTRTYRGHAADKKAKK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttctctcaagaagggtcctttccttgacctacacttgttgaagaaggtagag
aaggcggtggaaagcggggataaaaaaccaatcaaaacttggtcccgtcgttcaatgatc
attccatcaatgatcggattgaccatcgcagtccataatggtcgtcagcatgttccagtt
tatgtttctgatgaaatgatcggtcataaattaggtgaatttgcaccgactcgtacatac
cgcggtcacgccgcagataagaaagctaagaaataa

DBGET integrated database retrieval system