KEGG   Glaesserella parasuis ZJ0906: K756_11020Help
Entry
K756_11020        CDS       T02697                                 

Definition
(GenBank) neuraminidase/exo-alpha-sialidase nanH
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00511  Other glycan degradation
hpaz00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    K756_11020
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    K756_11020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hpaz02042]
    K756_11020
Enzymes [BR:hpaz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     K756_11020
Bacterial toxins [BR:hpaz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   K756_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_3 BNR_2 BNR GA SPACA9
Motif
Other DBs
NCBI-GeneID: 16167100
NCBI-ProteinID: AGO17299
Position
2117184..2119595
Genome map
AA seq 803 aa AA seqDB search
MKRRLSKNVKCSFVPSLIFLALASNLHATTFWKSDLNENLTHITKRVGQDNFTVAEEGRL
WPGIGPNGEAPGTVPLYYSRIPAMTITDDNKMVVMYDLRWNSASDQDRIDPGVSISEDGG
NTWLSKTAWTFNDSKMPLRRAMDPTILYNSIDGSIYAMHGTWATGNGFWYQDRFNYFQNN
IWATTIYKSIDGGKTWEKNAEFSKLSNPDVFSKVSKGPNNPVVSFLGGVGSGIVMRNGTL
VFPIQTAHNYGIAATIMYSKDNGKTWEMPETTDLPAPNQSSLENMVFEMGNKLIMVGREA
RVRGTQADKRWAYYTEDMGKSWHAYEPASFGSSTAQPTQGSSIYVTLPNGRRVLLVSKPN
GNNDNWARGNLALWMLDAKDPSHVYEVAIIRPGSGNAAGAGYSSLAYKEGNLFVAYEDDG
NITVKNLTQYMTDIQAKALEWNLPDEIEPDVEKINALMHLNQGQKDELIAKLRRANDNAI
AQSITLDQAMSELKLKSFALSQQAVSFEKALPSNLKNFQDALASINTISESKNTTNVNYL
GVHDLYDSLYTMFLALKNPLDFTKYIEQAKHLNEYNHDILYRSFDGVFAHYSGGSKYNKL
SLGGNKTVSEKVQAGLFFEYGNKHQKSYHVGMRAKYQLDNHQIAGFIRYRGVKHQDFIER
NNNVDLYLNYAYQLRLSEDLSMSPSFGAYISRSNRTLLDQDVAVNKRTVYAGDVGVNLMY
KINDINVNIRPNIAFINDSLKLSQSNDKSNVYKISSHNTIYGLATSINKAFSNGLKVGST
LELQKYGSQYSNVNLGVDISYTW
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagattatctaaaaatgttaaatgcagttttgtaccttcattgatttttcta
gcattagcatctaatttgcatgctactacgttctggaaaagcgatttaaacgagaatcta
actcatataactaaacgagtaggtcaggataattttacggtagctgaagaaggacgatta
tggcctggtataggtcctaatggagaggctcctggaacagtacctctatattatagccgt
attccagcaatgaccattacagatgataataaaatggttgttatgtatgatttaagatgg
aacagcgcatccgatcaagatagaatcgatccaggagtatccatttcagaagatggagga
aatacttggttaagtaaaacagcttggacatttaatgattctaaaatgcctttgcgaaga
gctatggatcctacgattttgtataacagtatagatggtagtatctatgctatgcatggg
acttgggctacaggtaatggattttggtatcaagatcgtttcaactattttcaaaataat
atttgggctacaaccatttataagtctatagatggagggaaaacttgggagaaaaatgct
gaatttagtaaattaagtaaccccgatgttttttctaaagtaagtaaaggtccaaataac
ccagtagttagttttttaggaggtgttggttctggtattgtgatgcgtaatggaacatta
gtatttccaatacaaactgctcataattatggtattgcagcaaccattatgtattctaaa
gataatggaaaaacttgggaaatgccagaaacaacggatcttccagcaccgaatcaaagc
tctttagagaatatggtttttgagatggggaataaattaattatggttggaagggaggcg
agagtaagaggaactcaagcagataaacgatgggcatactatacagaagatatgggtaag
agttggcatgcttatgaacctgcgagttttggttctagtacagcccaaccaactcaaggc
tcatcaatttatgttaccttgccaaacggtaggagagtattgctcgtttcaaaacctaat
ggtaataatgataactgggctaggggtaaccttgctctttggatgctagatgcaaaagat
ccatcacatgtatatgaggtggctattatcagacctggttctggaaatgcagcgggtgca
ggttattcatctttggcttataaagagggaaatttatttgttgcttatgaggatgatgga
aatattactgtaaaaaatttgacacaatatatgacagatattcaagctaaagcccttgaa
tggaatcttcctgatgaaattgaacctgatgttgaaaaaattaatgctttaatgcatttg
aatcaggggcaaaaagacgaattgattgctaaacttcgtagggcaaatgataacgcaata
gcacagtctattacgcttgatcaggctatgtcagaattaaaactcaaaagctttgcatta
agtcaacaagcggtttcttttgaaaaggctttaccatccaatcttaagaatttccaagat
gcattagcatctattaatactatttcagaatctaagaatacaacaaatgtcaattattta
ggtgttcatgatttatatgatagcttgtataccatgtttttagctttgaagaatccattg
gattttaccaaatatattgagcaggctaagcatttaaatgaatacaaccatgatattttg
tatcgctcctttgatggtgtttttgctcattatagtggaggttcaaaatataataagctc
tctttaggtggaaataagacggttagtgaaaaagttcaggctggattgttttttgaatat
ggcaataaacatcaaaaaagttatcacgttggtatgagagcaaaatatcaactggataat
catcagattgctggttttattcgttaccgtggcgtaaaacaccaagactttattgaacgt
aataacaatgttgatctttatttgaactatgcttatcaacttagattgagtgaagatctg
agtatgagtccttcgtttggtgcctatatttctcgttccaatagaacattgttagatcag
gatgtcgctgttaataagagaacagtttatgctggagatgttggtgtgaatcttatgtat
aagataaatgatattaatgtaaatatccggccaaatattgcattcatcaatgacagtctg
aaactatctcaatctaatgataagagtaatgtgtataaaattagttcacataatacaatt
tatggattggcaactagtattaataaagctttttcaaatggattgaaagtaggttcaaca
ttagaattgcaaaaatatggtagtcaatattctaatgtaaatttaggtgtagatatcagt
tatacttggtaa

DBGET integrated database retrieval system