KEGG   Glaesserella parasuis ZJ0906: K756_11065Help
Entry
K756_11065        CDS       T02697                                 

Definition
(GenBank) F0F1 ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00190  Oxidative phosphorylation
hpaz01100  Metabolic pathways
Module
hpaz_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K756_11065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:hpaz00194]
    K756_11065
Enzymes [BR:hpaz01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     K756_11065
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     K756_11065
Photosynthesis proteins [BR:hpaz00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   K756_11065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase HAS-barrel ATPase_2
Motif
Other DBs
NCBI-GeneID: 16167075
NCBI-ProteinID: AGO17306
Position
2125352..2126893
Genome map
AA seq 513 aa AA seqDB search
MQLNSTEISELIKKRIAQFNVVSEAQSTGTIVSVSDGVIRIHGLADVMQGEMIALPGNRY
AIALNLERDSVGAVVMGPYADLAEGMEVKCTGRILEVPVGRGLLGRVVNTLGQPIDGKGE
IDNDGFSPIEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI
DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALQNTIVVVASASESAALQYLAPY
AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER
AARVNADYVERFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSFF
NAGIRPAVNPGISVSRVGGSAQTKLVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ
LSHGQKVTELLKQKQFEPMSAAQLGLSLAAAEFGYLDDVEVERVGSFESNLLAYANANYA
EFMKDLSKSGDFNDTIKAKLIEILDSFKKNSAW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaaattctacagaaattagtgaattgattaaaaaacgtattgcacagttcaat
gtggtcagtgaagcacaaagtactggtacaatcgtttcagtcagcgacggggttattcgt
atccacggtctcgctgatgtaatgcaaggtgagatgattgcattaccaggcaatcgttat
gcgattgctttaaacttagaaagagattcagttggtgcagtagtaatgggtccatacgca
gatttagcagagggtatggaagtgaaatgtactggccgtattttagaagtccctgttggt
cgtggtttattaggtcgtgtagtaaacacattaggtcagccaatcgatggtaaaggtgaa
atcgataatgacggtttctcgccaatcgaagtgattgcaccgggcgttatcgaccgccaa
tctgttgatcaaccagttcagactggctataaagccgttgactcaatggtgccaatcggt
cgtggtcagcgtgagttaatcatcggtgaccgtcaaacaggtaaaacagcattagcgatt
gatgcgatcattaaccaacgtgattcaggtattaaatgtatctatgtggctatcggtcaa
aaagcgtctaccatttctaacgtagtacgtaaattagaagaacacggtgcgttacaaaat
actatcgtggtggtagcaagtgcatcagaatctgcagcattacaatatttagcaccttat
gcaggttgtgcaatgggtgaatacttccgtgatcgtggtgaagatgcgttaatcgtttac
gatgatttatctaagcaagcagttgcttaccgtcaaatttcattgttattacgtcgtcca
ccaggtcgtgaagcctatccaggtgatgtattctacctacactctcgtttacttgagcgt
gctgctcgtgtaaatgcagattatgtagaacgtttcaccaatggtgcagtaaaaggtcaa
acaggttctttaactgcattaccaattattgaaacccaagcaggtgacgtttcagcattc
gttccaacaaacgtaatttcgattaccgatggtcagatcttcttagaaaccagcttcttt
aacgcaggtattcgtccagcggtgaacccaggtatttcggtatctcgtgttggtggttct
gcacaaactaaacttgttaagaaattagcgggtggtatccgtactgcacttgctcagtac
cgtgaattagcagcctttgcgcagtttgcttcagatcttgatgatgcaacacgtaagcaa
ctttcacacggtcaaaaagtaacagagttacttaaacagaaacaatttgaaccaatgtct
gcggcacaattaggtttatcacttgcagcagctgaatttggttatttagatgatgttgaa
gttgagcgtgtaggttcatttgaatcaaatcttttagcttatgcaaatgcaaattatgct
gagtttatgaaagatttaagtaaatcaggcgatttcaatgacactatcaaagcgaaatta
atcgagattttagatagtttcaaaaagaatagtgcttggtaa

DBGET integrated database retrieval system