KEGG   Glaesserella parasuis ZJ0906: K756_11070Help
Entry
K756_11070        CDS       T02697                                 

Definition
(GenBank) F0F1 ATP synthase subunit gamma
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00190  Oxidative phosphorylation
hpaz01100  Metabolic pathways
Module
hpaz_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K756_11070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:hpaz00194]
    K756_11070
Photosynthesis proteins [BR:hpaz00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   K756_11070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt
Motif
Other DBs
NCBI-GeneID: 16166493
NCBI-ProteinID: AGO17307
Position
2126916..2127782
Genome map
AA seq 288 aa AA seqDB search
MAGAKEIRTKIASVRNTQKITKAMEMVAASKMRKTQERMSASRPYSDAIRKVISHIAKGS
IDYKHPFLTEREVKKVGFIVVSTDRGLCGGLNINLFKTVLNELKTRKDKGVDSVLGLVGN
KAVSFFQSMGVEIKAQVTGLGDTPAMEDLVGIVNGMIENYRNGEVDEVYIIYNRFVNTMS
QKPTVQKLLPLPELEDDDLENKGSWDYIYEPNPKVLLDSLLVRYLESQVYQAIVDNLASE
QAARMVAMKAATDNAGNLINELQLVYNKARQASITNELNEIVAGAAAI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgctaaagagataagaaccaaaattgcaagtgttcgtaatacacaaaaaatt
accaaagcgatggagatggttgctgcatctaaaatgcgtaaaacgcaagaaagaatgtct
gcatcacgtccatactcagatgccattcgtaaggtaattagccatattgccaaaggaagt
attgattataaacatcctttcttaaccgaacgtgaagtcaaaaaagttggatttattgtt
gtttcaacggaccgtggtctatgcggtggcttaaacattaatttatttaaaaccgtttta
aatgagttaaaaacacgtaaagataaaggggtggattcagtcttaggattggttggaaac
aaagcagtttcatttttccaatcaatgggggtggaaatcaaagctcaagtaacgggctta
ggtgatacacctgcaatggaagatttagttggtattgtaaatggtatgattgaaaactac
cgtaatggcgaagttgatgaagtctatattatttataaccgcttcgtgaatacgatgtcg
caaaaaccaacggttcaaaaattacttccattgccagaacttgaagatgacgatttggaa
aataaaggttcgtgggattatatctatgagcctaatccaaaagtgttgctagatagctta
cttgttcgctatttagaatctcaagtttatcaagcgatcgtagataatcttgcatctgaa
caggcagctcgaatggtagcaatgaaagcagcaacggataacgcaggtaatttaatcaat
gagttacagttggtgtataacaaagctcgtcaagcaagtattacgaatgaattaaatgaa
attgtcgcgggtgccgcagcaatttaa

DBGET integrated database retrieval system