KEGG   Glaesserella parasuis ZJ0906: K756_11075Help
Entry
K756_11075        CDS       T02697                                 

Definition
(GenBank) F0F1 ATP synthase subunit beta/H(+)-transporting two-sector ATPase, F(1) subunit beta
  KO
K02112  F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz01100  Metabolic pathways
Module
hpaz_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K756_11075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:hpaz00194]
    K756_11075
Enzymes [BR:hpaz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     K756_11075
Photosynthesis proteins [BR:hpaz00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   K756_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N
Motif
Other DBs
NCBI-GeneID: 16166019
NCBI-ProteinID: AGO17308
Position
2127803..2129176
Genome map
AA seq 457 aa AA seqDB search
MATGKIVQIIGAVIDVEFPQDAVPKVYDALKVETGLTLEVQQQLGGGVVRCIALGTSDGL
KRGLKVENTNKAIEVPVGTKTLGRIMNVLGEPIDEAGPIGEEERWTIHRAAPSYEEQANS
TELLETGIKVIDLIAPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGER
TREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLFFVD
NIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADD
LTDPSPATTFAHLDSTVVLSRNIASLGIYPAIDPLDSTSRQLDPLVVGQEHYDVARGVQK
TLQRYKELKDIIAILGMDELSEDDKLVVARARKIERFLSQPFHVAEVFNSVPGKFVPLKE
TIRGFKGILAGEYDHIPEQAFYMAGSIDEVVERANKM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggaaaaattgtacaaatcatcggtgcggtaatcgatgttgagtttccacaa
gatgcagtaccaaaagtttatgatgcattaaaagttgaaacaggtttaacccttgaagtt
caacaacaattaggcggtggtgtagtacgctgtatcgctcttggtacatctgatggttta
aaacgtggcttaaaagttgaaaatacgaataaagcgattgaagtaccagtgggtacaaaa
acgcttggtcgtattatgaacgtattaggtgagcctattgatgaagcaggtcctatcggt
gaagaagagcgttggacgattcatcgtgcagcaccaagctatgaagagcaagcaaacagc
acagaacttttagaaacagggatcaaagttatcgacttgatcgctccgtttgctaaaggg
ggtaaagttggtttattcggtggtgctggcgtaggtaaaacggtaaatatgatggagtta
atccgtaacatcgcaatcgaacactctggttactcagtattcgcaggtgttggtgagcgt
actcgtgaaggtaatgacttctaccacgagatgaaagactctaacgtattagataaagta
tcattggtttatggtcagatgaacgagccaccaggtaaccgtttacgtgttgcgttaact
ggtttaaccatggcggaaaaattccgtgatgaaggtcgtgacgtgttattcttcgtcgat
aacatctatcgttatacccttgcaggtacagaagtatcagcgttattaggtcgtatgcca
tctgcagtaggttaccaaccaacacttgcggaagaaatgggtgttctacaagaacgtatt
acgtcaaccaaaacaggttctatcacctcggttcaagcggtttacgttcctgcggatgac
ttaacagacccatcaccagcaacaacctttgctcacttagactcaacggttgtattaagc
cgtaatatcgcatcattgggtatttacccagcgatcgatccgcttgattcaacatcacgt
caattagaccctcttgttgttggtcaagagcactatgatgttgcacgtggcgtacaaaaa
acgcttcaacgttataaagagttgaaagacatcatcgcaattcttggtatggatgagtta
tcagaagatgacaaattagtggttgctcgtgcacgtaaaattgaacgtttcttatcacaa
ccattccacgtggcagaagtgttcaacagtgtaccaggcaaatttgtaccattaaaagaa
acaatccgtggctttaaaggcattttagcaggcgaatatgaccatatcccagaacaagcg
ttctatatggcaggttcaattgacgaagtggttgaaagagccaacaagatgtaa

DBGET integrated database retrieval system