KEGG   Glaesserella parasuis ZJ0906: K756_11080Help
Entry
K756_11080        CDS       T02697                                 

Gene name
atpC
Definition
(GenBank) F0F1 ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00190  Oxidative phosphorylation
hpaz01100  Metabolic pathways
Module
hpaz_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K756_11080 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:hpaz00194]
    K756_11080 (atpC)
Photosynthesis proteins [BR:hpaz00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   K756_11080 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-GeneID: 16165413
NCBI-ProteinID: AGO17309
Position
2129203..2129619
Genome map
AA seq 138 aa AA seqDB search
MTSFELTVVSAERKIFEGQVTSVRVSGVDGELGVYAGHTPLLTAIKPGMVKFTLEDNKEE
YIYVSGGFLEVQPTVVTVLADVAIRGEELDEQRILAAKRKAEETISKTNEADMTAKLARE
IAKLHVYELTKTKLANRR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatttgaactcacagtcgttagtgcagagcgtaaaatctttgaaggtcaagta
acgagtgttcgagtttcaggggtagatggggaattaggtgtctatgcaggacacacccca
ctattaaccgccattaaacccggcatggtcaaattcactttggaagataacaaagaagaa
tatatctatgtttcaggcggattccttgaagttcaaccaacggttgtgaccgtgcttgca
gacgttgcaattcgtggtgaagaactcgatgaacaacgtatccttgcagcaaaacgcaaa
gcagaagaaacaataagcaaaacaaatgaagcggatatgaccgccaaattagctcgcgaa
attgctaaactgcatgtttacgaactcactaaaacgaaattagcgaatagacgttaa

DBGET integrated database retrieval system