KEGG   Glaesserella parasuis ZJ0906: K756_11085Help
Entry
K756_11085        CDS       T02697                                 

Definition
(GenBank) ribose operon repressor
  KO
K02529  LacI family transcriptional regulator
Organism
hpaz  Glaesserella parasuis ZJ0906
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hpaz03000]
    K756_11085
Transcription factors [BR:hpaz03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    K756_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_24 HTH_38 HTH_23 HTH_3 DUF3853
Motif
Other DBs
NCBI-GeneID: 16167336
NCBI-ProteinID: AGO17310
Position
2129694..2130683
Genome map
AA seq 329 aa AA seqDB search
MATMKDIARIAGVSLSTVSHVVNNSRFVSEEITLKVKKVIEELNYRPSLVARSLKIKETN
TIGMIVTTSNNPFFAEVVRHVERYCERHHYHLILVNTDGNSQNLQQHLERLLLKQVDGLL
LMCAEPQNFDLSAMTNLTLPMVVIDWWQQSLNADIIHENSVLGGYLATKAFIDAGYHDIA
IITGELSKPLAQNRLAGYKRVLLENNLQIRPEWIIESHFHYDGGVEAMTKLLALENRPRA
VFAMSDSIAIGAYQVIQRAGLRIPQDIAIIGYDNIELAQYLYPPLSTIHQPKARLAKAAV
EKLILRIHQPQTEIETIKLTPELIIRESF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatgaaagatatagctcgaattgcaggggtttcactttcgaccgtttctcat
gtggtaaataattcgcgctttgtcagtgaagaaattaccttgaaagtcaaaaaagtgatt
gaagagcttaattaccgtccttcattggtggcaagaagcttaaagatcaaggaaaccaat
accattggtatgattgtgacgactagcaataaccccttttttgccgaagtggttcgccat
gtcgaacgttattgtgaacgccatcattaccatctgattttagtcaataccgacggcaac
agtcaaaatttacagcaacatctagagagattgttattaaaacaagttgatggtctattg
ctgatgtgtgcagagccacaaaattttgacttaagtgcgatgacaaatttaacattgcct
atggtagtgattgactggtggcaacagtcgctcaatgccgatattattcacgaaaattca
gtattaggcgggtatcttgcgacaaaagcgtttatcgatgctggttatcacgatatagcc
attattactggtgaactttcaaaacctttggctcaaaatcgtttagctggctacaagcgg
gtacttttagagaataatttgcaaattcgccccgaatggattattgaaagccatttccat
tatgacggtggtgtcgaggcgatgactaaactgttggcgctggaaaatcgcccgcgtgcg
gtttttgctatgagtgatagcattgcgattggtgcgtatcaagtcattcaacgtgcagga
ttgcgtattccacaagatattgcgattatcggttacgataatattgaactggctcaatat
ctttatcctccactttccaccattcatcaacccaaagcacgactagcgaaagccgcggtt
gagaaattaattttacgcattcatcagccacaaacggaaatagaaacgataaaactgacg
cccgaattgattattcgagaatccttttaa

DBGET integrated database retrieval system