KEGG   Glaesserella parasuis ZJ0906: K756_11090Help
Entry
K756_11090        CDS       T02697                                 

Definition
(GenBank) D-ribose pyranase
  KO
K06726  D-ribose pyranase [EC:5.4.99.62]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K756_11090
Enzymes [BR:hpaz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.62  D-ribose pyranase
     K756_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbsD_FucU
Motif
Other DBs
NCBI-GeneID: 16166188
NCBI-ProteinID: AGO17311
Position
2130794..2131222
Genome map
AA seq 142 aa AA seqDB search
MKKTTILNAQLSHVIATMGHTDGLTICDSGLPIPTEQHCIDLALTKGIPDFLSVLQAVLS
ELFIEKIVLAEEIKNINPQIEQQLLMVIQQIEVQQKIPLRLNISHITNLNIKVIKPKPSL
ERENVARMRMLFFIRAYHFRWI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacaacaatcttaaatgctcaactttcacatgtaattgcaacaatgggacat
accgatggactcacaatttgtgattctggtttaccaattccaacagagcagcattgcatt
gaccttgctttaaccaaaggtatccccgattttctttcagtcttacaagcggtattaagt
gaattatttattgaaaaaattgtattagctgaagaaatcaagaatattaatcctcaaatt
gaacaacagttattaatggttatccaacaaatagaggtgcaacaaaaaataccattaaga
ttgaatatatcccacataacgaatttaaacatcaaagtaatcaagccaaagccgtcgtta
gaacgggagaatgtagcccgtatgcgaatgttattctttattcgggcgtaccattttagg
tggatatga

DBGET integrated database retrieval system