KEGG   Glaesserella parasuis ZJ0906: K756_11100Help
Entry
K756_11100        CDS       T02697                                 

Gene name
rbsC
Definition
(GenBank) ribose ABC transporter permease protein
  KO
K10440  ribose transport system permease protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz02010  ABC transporters
Module
hpaz_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K756_11100 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpaz02000]
    K756_11100 (rbsC)
Transporters [BR:hpaz02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    K756_11100 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 TB2_DP1_HVA22
Motif
Other DBs
NCBI-GeneID: 16165919
NCBI-ProteinID: AGO17313
Position
2132733..2133692
Genome map
AA seq 319 aa AA seqDB search
MNKSFNFTKFLIDQRSIIALITMIVVVSFLNPDFFTTDNLLNILRQTSVNAIIAIGMTFV
ILIAGIDLSVGSVLALTGAVAATLVGMDLPVYAVIPTVLIFGGLIGLLNGSLVAFGKVQA
FMATLITMLLLRGVTMIYMGGRPISTGFSENADAFAEIGTGIWLGIPVPVWLMFALFALG
WFVLTQTRMGRYIYALGGNESATALSGINVNKVKLFVFAVSGVLAALAGLIITSRLGSAQ
PTAGTGYELDAIAAVVVGGTSLMGGKGRIIGTLIGALIIGFLSNALNLLDIDSYYQLVAK
ALVILAAVILDNFIGRKKV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgtttaacttcactaaatttttaatcgaccaacggtcgatcattgcatta
atcacgatgattgtcgtggtgtcatttctaaatccggatttttttactacggataacttg
ctcaacattctgcgccaaacctcggtgaacgccattattgcgattgggatgacttttgtg
attttgattgccggtattgatttatcggttggttcagtacttgctttgacgggagctgtg
gctgcaaccttagtcggtatggatttaccggtttatgccgtgattcctacggtactgatt
tttggcggactgatcggcttgttgaacggatcgttggtggcattcggtaaagtacaagcc
tttatggcaaccttgattacgatgctgttattacgtggcgtgaccatgatttatatgggt
ggtcgcccgattagcaccggtttttccgagaatgctgatgctttcgccgaaatcggcaca
gggatttggctcggtattccagttcctgtttggctgatgtttgccttatttgcattaggt
tggtttgttctgacccagacgcgtatggggcgttatatttatgccttagggggcaacgaa
tcggcaaccgcactttcaggtattaatgtaaataaagttaaactctttgtgtttgctgtc
agcggtgtattggctgcccttgctggtttgatcatcacctctcgtttaggctctgcccaa
ccaaccgcaggaacaggctatgaattagatgcgatagcggctgttgtagtgggtggcacc
agtcttatgggcggtaaaggtcgtattatcggcacgttaatcggtgcattaattattggt
ttcttgagcaatgccttgaatttattagacattgactcttactatcaactggttgcgaaa
gcgctggtaatcttagctgcggttatcttagataacttcattggtcgtaaaaaagtctag

DBGET integrated database retrieval system