KEGG   Glaesserella parasuis ZJ0906: K756_11125Help
Entry
K756_11125        CDS       T02697                                 

Definition
(GenBank) hypothetical protein
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SirB
Motif
Other DBs
NCBI-GeneID: 16165144
NCBI-ProteinID: AGO17318
Position
2138405..2138599
Genome map
AA seq 64 aa AA seqDB search
MQILGSWSPFTETWLAIKLLLVVVYIVFGVVAQKNIRTPKGFAFYSLSLLAFLTMVLLSL
CKIG
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactcggctcttggtcgccatttacagaaacttggttagcgataaagttgtta
cttgtcgtggtctatatcgttttcggtgttgtggcacaaaaaaacattcgcaccccaaaa
gggttcgcgttttacagcttgtcgctactcgcttttttaacaatggtgttgctatcgctt
tgcaaaataggctaa

DBGET integrated database retrieval system