KEGG   Glaesserella parasuis ZJ0906: K756_11130Help
Entry
K756_11130        CDS       T02697                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K07124  uncharacterized protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    K756_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase Sacchrp_dh_NADP Pyr_redox Shikimate_DH RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 16166222
NCBI-ProteinID: AGO17319
Position
complement(2138576..2139226)
Genome map
AA seq 216 aa AA seqDB search
MKQTALITGASNGIGLELAKIHAKKGGDVVLVARSKEKLAELAHDLANTYGIKATVIAQD
LSEPNAAQAIFAQTEAQGITVDILINNAGFGGHGRFFERDLAKEQQMIQVNITTLTELSH
FYLKGMVERRCGKILNVSSTAGFLPGPLQAVYYATKAYVTSFSQAIAEEVAEFGVTVTAL
CPGAVATGFVKNLHFISFYFSWLISSVYVLAYFAKR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacagcattgattacaggtgcatcaaatggtatcggtttggaactagcaaaa
attcacgccaaaaaaggcggcgatgtggtgttggtggcacgttcaaaagagaaattggcc
gaactagcacacgacttagctaacacatacggtattaaagccaccgttatcgcccaagat
ttatcagaacctaatgcggcacaagcgatttttgcacagacggaagcacagggcattacc
gttgatattctaatcaataatgcaggttttggcggacacggtcgcttttttgagcgtgat
ttagccaaagaacaacaaatgatccaagtaaacatcaccactttaaccgagttaagccat
ttttacttaaaaggtatggtggaacgccgctgtggtaaaattctaaacgtttcttcaacg
gcaggctttttacctggtccattacaagcggtttattatgcaacaaaagcctatgtcacg
tctttcagccaagccattgccgaagaagtggcagaatttggcgtaactgtaaccgcactt
tgtccaggggctgtggcaacaggttttgtaaaaaatcttcattttatttccttttatttc
agttggttaataagttcggtgtacgtcttagcctattttgcaaagcgatag

DBGET integrated database retrieval system