KEGG   Glaesserella parasuis ZJ0906: K756_11135Help
Entry
K756_11135        CDS       T02697                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding AraC_binding_2 HTH_18
Motif
Other DBs
NCBI-GeneID: 16166578
NCBI-ProteinID: AGO17320
Position
2139312..2140058
Genome map
AA seq 248 aa AA seqDB search
MAKIGNTQAIPTPQSALEICLFSEFNQSNLHADELTREMLAEQHRFDFYVWLWVTEGECQ
HLLDFQSVTQRTGEWLLIRPQQVHHFQTMEGWDGWGLSFPAEWVSADLASIWQQLPQKQS
VTAEQAPLLQLALQQLKQYRYFEWQGQNYQLLLQTQLHTFLTLLNTLYAANQPQEDHQNQ
RWQGFSQLLEQHFCTQHQVQFYAEQLGCTEKKPLGSTCLAHTGLPAKMVINQRLLLEAKR
LLVHTQNP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataggaaatacacaagcaatccccacaccgcaatcggcacttgaaatttgt
ctatttagtgaatttaaccaaagcaatttgcacgctgatgaattaacacgggaaatgctc
gctgagcaacatcgctttgatttttatgtttggctgtgggtaacagaaggggaatgtcag
catttgcttgatttccaaagcgttacgcaacgcacaggcgaatggttgctgatccgccca
cagcaagttcaccattttcaaacaatggaaggttgggacggttggggattatcttttcca
gccgaatgggtttctgctgatttagcctcaatttggcaacagctgccacaaaagcaatct
gtaaccgccgagcaagcccctttgctgcaactggcgttacaacagctcaaacaatatcgc
tactttgaatggcaagggcaaaattatcagctcttattacaaacgcagttacacaccttt
ctgaccttgctcaacaccctttatgctgcaaatcagccacaagaagaccaccaaaatcaa
cgttggcaaggtttttctcagctattggaacaacatttttgcacgcaacatcaagtccaa
ttttatgcggaacaactcggttgcacagaaaaaaaaccgctcggctcaacctgtttagca
catacggggctgcctgccaaaatggttatcaaccaacgtttgctacttgaagccaaacgc
ctactggtgcatacccaaaatccgtga

DBGET integrated database retrieval system