KEGG   Glaesserella parasuis ZJ0906: K756_11145Help
Entry
K756_11145        CDS       T02697                                 

Definition
(GenBank) pyruvate kinase
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 SnoaL Phage_T4_gp19
Motif
Other DBs
NCBI-GeneID: 16165987
NCBI-ProteinID: AGO17322
Position
complement(2140498..2140941)
Genome map
AA seq 147 aa AA seqDB search
MKKLLLLLTALFSSTVAMAQTTPEQNKANALAFYEMAFNQHQLQDAVDKYIGKEYLQHNP
SVADGGQAFIDAFAPFLKEHPTSRATVKRVLADGDLVALHVHSQLNEKDKGEAVVDIFRF
DENGKIVEHWDVIQAVPEKTESGRGMF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattacttttacttttaactgcacttttctcatcaaccgttgcaatggcacaa
actacgccagagcaaaataaagcgaatgcattggcgttctatgaaatggcgtttaaccaa
catcaattacaagacgcagtggataaatatatcggcaaagagtatttgcaacacaaccca
agtgtagccgatggtggtcaagcctttattgatgcttttgctccgtttttgaaagaacac
ccaacttcgcgagcaacagttaaacgtgtattagcggacggcgatttagtagcattacac
gttcacagccagctcaatgaaaaagataaaggcgaagcggtggtggatattttccgtttc
gatgaaaacggcaaaattgtagaacattgggacgtaatccaagcggtaccagaaaaaaca
gaaagcggacgtggaatgttttaa

DBGET integrated database retrieval system