KEGG   Glaesserella parasuis ZJ0906: K756_11175Help
Entry
K756_11175        CDS       T02697                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K756_11175 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpaz01007]
    K756_11175 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpaz03016]
    K756_11175 (aspS)
   03029 Mitochondrial biogenesis [BR:hpaz03029]
    K756_11175 (aspS)
Enzymes [BR:hpaz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     K756_11175 (aspS)
Amino acid related enzymes [BR:hpaz01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   K756_11175 (aspS)
Transfer RNA biogenesis [BR:hpaz03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K756_11175 (aspS)
 Prokaryotic Type
   Other AARSs
    K756_11175 (aspS)
Mitochondrial biogenesis [BR:hpaz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    K756_11175 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d Vps23_core
Motif
Other DBs
NCBI-GeneID: 16165686
NCBI-ProteinID: AGO17328
Position
complement(2147572..2149341)
Genome map
AA seq 589 aa AA seqDB search
MRSHYCGVLNRTHVGEQVTLSGWVHRVRNLGRFIFMQIRDREGIVQVFFDEKDEALFKQA
SALRAEACVQIKGEVIARDTSQINKEMATGEIEVLVKELVVYNNSDVLPLDFNQNNTEEQ
RLKYRYLDLRRPEMAERLKTRAKITSFVRRYMDDNGFLDIETPMLTKATPEGARDYLVPS
RVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETTFMT
APEVRAMMEKMIRGLWLDRLNVDLGEFPQMTFAEAMRRYGSDKPDLRNPLELVDVADILK
DVEFKVFSGPANDPEGRVAVIRVPNGAEITRKQIDEYTQFVGNYGAKGLAWAKVNDVNAG
LEGLQSPIAKFLTDDVVKALLARVNAQNGDIIFFGADSEKVVTDAMGALRLKVGRDLGLT
DLTAWKPLWVVDFPMFEKDDEGNWSAMHHPFTAPKDLSPEELVQDPKGAVANAYDMVING
YEVGGGSVRIFDPKMQQTVFGILGINEEEQKEKFGFLLDALKFGTPPHAGLAFGLDRLTM
LITGTENIRDVIAFPKTTAAACLMTDAPSFGNPKALAELAIQTTVEKES
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctcattattgcggtgtgttaaaccgtactcacgttggtgagcaagtaacatta
agcggttgggtacaccgtgtccgtaaccttggtcgttttatttttatgcaaattcgtgac
cgtgaagggatcgtgcaggttttctttgatgagaaagatgaagccttattcaaacaagcc
tctgcattgcgtgcggaagcctgcgtgcaaattaaaggtgaagtgattgctcgtgataca
tctcaaattaataaagagatggcaacaggtgaaattgaagtgttggtcaaagaacttgtg
gtatataacaattcagacgtattaccgctcgatttcaatcagaacaacaccgaagaacag
cgtttaaaataccgttatttagatttacgccgtcctgaaatggcggaacgtttgaaaacc
cgtgcaaaaattaccagctttgttcgtcgttatatggacgacaatggttttctggacatt
gaaactccaatgctcaccaaagcaactcctgaaggtgcgcgtgactatttagtgccaagc
cgtgtgcataaaggcaaattctatgcgttaccgcaatcaccgcaattatttaaacagttg
ctgatgatgtcaggttttgaccgttactaccaaatcgtcaaatgtttccgtgatgaagat
ttgcgtgcagatcgtcagcctgaatttacccaaatcgatgtggaaaccacctttatgacc
gcccctgaagtgcgtgcgatgatggaaaaaatgatccgcggcttgtggttagatcgttta
aatgttgatttaggcgagttcccacaaatgacttttgcagaagcaatgcgtcgttatggt
tcagacaaacccgatctgcgtaacccgttagaattagttgatgtggcggatattctaaaa
gatgttgaatttaaagtattcagtggtccagcaaacgatcctgaagggcgtgttgcggtc
attcgtgtgccgaatggtgcggaaattacccgtaaacagattgatgaatatactcaattt
gttgggaactatggcgcaaaaggcttagcgtgggcaaaagtgaatgatgtaaacgcaggc
ttagaaggtttgcaaagcccgattgctaagttcttaactgatgatgtggttaaagcatta
ttagcgcgtgtcaatgcacaaaatggcgatattatcttctttggtgcggacagtgaaaaa
gtggttacagatgcgatgggtgcgttacgtttgaaagtgggacgtgatttaggtttaacg
gatctcaccgcttggaaaccgctttgggttgtcgatttcccaatgtttgaaaaagatgat
gagggtaactggtcagcaatgcaccacccattcaccgcaccaaaagatttaagccctgaa
gagcttgtgcaagatccaaaaggtgcagtagcaaatgcttacgatatggtgattaacggc
tatgaagtaggcggtggctctgtgcgtattttcgacccaaaaatgcaacaaacggtattc
ggtattttaggcattaacgaagaagaacaaaaagagaaattcggcttcttgttagacgca
ttaaaatttggtacaccaccacacgcaggcttggcgttcggtttagaccgtttaacgatg
ttaattactggcacagaaaatatccgtgatgtgattgccttcccgaaaacaacggcggca
gcttgcttgatgaccgatgcaccaagtttcggtaatccgaaagcgttagcagagttggcg
attcagacaacggtggaaaaagaatcgtaa

DBGET integrated database retrieval system