KEGG   Glaesserella parasuis ZJ0906: K756_11225Help
Entry
K756_11225        CDS       T02697                                 

Definition
(GenBank) xanthine/uracil/vitamin C permease
  KO
K06901  putative MFS transporter, AGZA family, xanthine/uracil permease
Organism
hpaz  Glaesserella parasuis ZJ0906
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpaz02000]
    K756_11225
Transporters [BR:hpaz02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Purine transporter (AzgA) family [TC:2.A.1.40]
    K756_11225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-GeneID: 16165081
NCBI-ProteinID: AGO17338
Position
complement(2160597..2161892)
Genome map
AA seq 431 aa AA seqDB search
MLERLFQLKEKGSNVKTEIVAGITTFFTMVYIVFVNPSILGVAGMDTQVVFVTTCLIAAF
GTIAMGLFSNLPIALAPAMGLNAFFAFVVVQKLGYTWQTGMGAIFWGSVGLFILTILQVR
YWFMSAIPLGLRVGIGAGIGLFIALIGFKNMGLVVANPATLVALGELHDPKVLMGILGFF
IIVVLAAKGIHSGVLISIVVVTALALIFDPDVKFSGVISIPPSLEAVVGQVDIAGALDTA
LLGIIFSFMLVNLFDSSGTLIAVTNKAGIADEQGRFPKMKQALYVDSVSAMAGSYMGTSA
ISTYIESGSGVSVGGRTGLTAVVVGVLFLLTIFFSPLAAVVPTYATAGALVFVGILMASS
LIEVKWDDLTEATPAFITTAMMPFTYSITEGIAFGFISYCIMKLCTGRVKEINPAVAVVS
LLFIAKFVWVG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaacgtttgtttcaattaaaagaaaaaggcagtaatgtcaaaactgaaattgtg
gcagggatcaccacattctttacgatggtttatatcgttttcgtcaacccatctatttta
ggtgtggctggtatggatacccaagttgtctttgtgaccacctgtttaatcgccgctttt
ggtactattgcgatgggtttatttagtaacttgccgatcgctcttgcccctgcaatggga
ttgaatgccttttttgcatttgtcgtcgttcaaaaactcggctatacgtggcagacagga
atgggggcaatcttctggggttctgtcggtctatttattctcacgatattacaagttcgc
tactggtttatgtcagccattccacttggtttacgtgtgggtattggtgcaggtatcggc
ttatttattgcgttaatcggctttaaaaatatggggcttgttgtcgcaaaccctgcgacc
ttagtggcgttaggtgaattgcacgatccaaaagtcttaatgggtattttaggcttcttt
attatcgtggtactggctgcaaaaggtattcattctggcgtattaatttcaatcgttgtt
gtgacggcattagcgttaatctttgatcctgatgtcaaattctcaggcgtgatttcaata
ccaccaagccttgaagctgttgttggacaagtcgatatcgcaggggcattagataccgca
ttgctggggattatcttttcctttatgttggttaacttgtttgactcatcaggaacatta
attgcggttacgaataaagctggaattgccgatgaacaaggtcgcttcccaaaaatgaaa
caggcactttatgtcgatagcgtcagcgctatggcgggttcttatatgggaacatcagcg
atcagtacctatattgaaagtggttctggggtttctgttggtggacgcacaggtttaact
gctgtcgtggtgggcgtgcttttcctattaacgatcttcttttcaccgcttgcagctgtt
gtgcctacttatgcaacggctggtgctttagtgtttgtcggcattttaatggcttcaagt
ttaattgaagtaaaatgggacgacttaaccgaagcgacacctgcatttattactacagcg
atgatgccatttacctattcaattactgaagggattgcctttggtttcattagctattgc
attatgaagctctgtacaggtcgagtaaaagagattaaccctgctgttgcggtggtttca
ctgctctttattgctaaatttgtttgggttggataa

DBGET integrated database retrieval system