KEGG   Glaesserella parasuis ZJ0906: K756_11240Help
Entry
K756_11240        CDS       T02697                                 

Definition
(GenBank) carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    K756_11240
Enzymes [BR:hpaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     K756_11240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 16166282
NCBI-ProteinID: AGO17341
Position
complement(2163431..2164093)
Genome map
AA seq 220 aa AA seqDB search
MKKIERLFANNHAWATQMKDEHSDYFKQLAEHQKPSFLWIGCSDSRVPAEKLTGLEPGEL
FVHRNVGNLVIHTDLNCLSVVQYAVDVLDIEHIIICGHTNCGGIKAAIGMEDHGLISNWL
LHIRDLWFKHSHLLGKISPEHRGDMLVRLNVAEQVYNLGRSTIVKSAWERGKKLSIHGWV
YDVNDGFLNDQGVMATSRESLEITYRNAIAKLLREGDNNS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaacgtctgtttgcaaataatcatgcttgggcaactcaaatgaaagat
gagcattcagattattttaaacagctagcagaacatcagaaacctagttttttatggatt
ggatgttcagatagtcgagttcctgctgagaagttgacgggattagagccaggagaacta
ttcgttcatagaaatgtggggaatcttgtcattcacaccgatttaaattgtctttcagtt
gtacaatatgctgtggatgtgctggatatcgaacatattattatttgtgggcataccaac
tgtggcggtattaaggctgcaattggaatggaagatcatggtttaattagcaattggcta
ctgcatattcgagatctatggtttaaacatagccatcttcttggaaaaatatctcccgaa
cataggggggatatgttagttcgtttgaatgtagcggaacaggtttataatttgggacgt
tcaactattgttaaatcagcttgggagagagggaaaaaactctctattcatggttgggtc
tatgatgttaatgatgggttcttaaatgatcaaggtgttatggcgacaagtcgagagagc
ttagagatcacttatcgtaatgcaatcgcaaaactattgagagagggtgacaataactca
tag

DBGET integrated database retrieval system