KEGG   Glaesserella parasuis ZJ0906: K756_11245Help
Entry
K756_11245        CDS       T02697                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz02010  ABC transporters
Module
hpaz_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K756_11245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpaz02000]
    K756_11245
Enzymes [BR:hpaz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     K756_11245
Transporters [BR:hpaz02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    K756_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_29 RsgA_GTPase AAA_16 SMC_N NACHT AAA_23 AAA_22 FtsK_SpoIIIE AAA_21 MMR_HSR1 AAA_33 AAA_30 ArgK Zeta_toxin AAA_25 AAA_28 DUF87 AAA_24 Dynamin_N
Motif
Other DBs
NCBI-GeneID: 16166624
NCBI-ProteinID: AGO17342
Position
2164449..2165012
Genome map
AA seq 187 aa AA seqDB search
MSSNELLRCENISKFYQEGGNATQVLKNVSFSMNAGELVAIVGSSGSGKSTLLHTLGGLD
QPSDGEVFIKGQSLQKLSSNALAKLRNQHLGFVYQFHHLMADFSALENVMMPMLIGQQNK
TEAKDRAEKMLQAVGLAHRITHRPSALSGGERQRVAIARALVNNPALVLADEPTGNLDQK
QPKVFLS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaacgaacttcttcgctgtgaaaatatcagcaaattttaccaagagggcgga
aatgccactcaggtgcttaaaaatgtatccttttcaatgaatgcaggcgaacttgtggcg
attgttggtagctccggatcaggcaaaagtaccttgttacacactcttggtggtttggat
caaccgagtgacggcgaggtctttatcaaagggcaatcattgcagaagctcagtagcaat
gctcttgcaaaactacgcaatcaacatctgggctttgtctatcaatttcatcacttaatg
gcggatttctctgcgttggaaaatgtgatgatgccaatgttaatcgggcaacaaaacaaa
acagaagccaaagatcgggcagaaaaaatgttacaagcggtcggattggctcatcgaatt
acccatcgaccttcggcgttatcgggcggtgaacgccagcgtgttgcgattgctcgtgcg
ttggtgaataaccctgcgttggttcttgctgatgaaccaacgggtaatctcgaccaaaaa
caaccgaaagtatttttgagctaa

DBGET integrated database retrieval system