KEGG   Glaesserella parasuis ZJ0906: K756_11265Help
Entry
K756_11265        CDS       T02697                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03885  NADH dehydrogenase [EC:1.6.99.3]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    K756_11265
Enzymes [BR:hpaz01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     K756_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO K_oxygenase NAD_binding_9 NAD_binding_8 Lysine_decarbox
Motif
Other DBs
NCBI-GeneID: 16165691
NCBI-ProteinID: AGO17346
Position
complement(2168467..2169750)
Genome map
AA seq 427 aa AA seqDB search
METIVIVGGGAGGLELATYLGNKLGKKKKANIILVDKNISHLWKPLLHEVATGSLDDGTD
ALSYRAHAKNHHFEFRQGTLTQVKPAEKIIVLAPIYDEAGELLVAERTIVYDKLVLAIGS
RSNDFNTPGVAEHCIFLDSSEQAKVFHKRMMELFLKFSNNNEKEVHIAVVGGGATGIELS
AELYNAVKHLNSYGYGKLDNTSLKVTLLEAGERLLPALPERVSASAIKELRALGVDVLTN
TPVIRATAEGLVTKYDENFKADLMVWAAGVKAPEITKTFGFETNRINQIAIKDTLQTLTD
ENVYVIGDCAFLLQADGKPVPPRAQSAHQMAAVCGKNILAQLENKPLKAFIFDDKGSLIS
FSRFGTVGSLMGNLTKGSMFIEGKIARMAYLSLYRMHQVALHGCVKTGLIMLVGRINRFL
RPTMKLH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgatcgttatcgttggcggcggtgcaggtggattagagcttgcaacttattta
ggtaacaaattaggtaaaaagaaaaaggcaaatattattttggtggataaaaatattagc
catttatggaaaccgttacttcatgaagttgcaacaggctctttagatgatggtactgat
gctttaagttatcgtgcccatgcgaaaaatcatcactttgaatttcgtcaaggcacatta
actcaagttaaaccagcagaaaaaatcattgtattagccccaatctatgatgaggcgggg
gaattattagtagcggaacgtaccattgtctatgataaattggttcttgcaatcggaagt
cgctcaaatgattttaatacgcctggtgttgcagaacactgtattttcttagacagttca
gagcaagcaaaagtattccataaacgtatgatggaattgtttttgaaattttcaaataat
aatgaaaaagaagttcatatcgctgttgttggtggcggggctacaggtattgaattatcc
gcagaactgtataatgcggttaaacatttaaattcttatggatatggtaagttagataat
actagcttgaaggtgacattattagaagcaggagaacgcttgttgcctgcgttacccgaa
agggtatcggcatctgcaattaaagagttacgtgcattgggtgtagatgtgttaaccaat
actcctgttattcgtgcaactgcggagggattagttactaaatatgatgaaaactttaaa
gcagatctgatggtttgggcggcaggtgttaaagcccctgaaataacaaaaacatttggc
tttgaaactaatcgtattaatcaaattgcaatcaaagatactttacagacattaactgat
gagaacgtctatgtgattggtgactgtgcctttttgctacaagcagatggtaagcctgtt
cctcctagagcccaatcggcacatcaaatggcagcggtttgtggtaaaaatatcttagca
caattagaaaacaaacctttaaaggcttttatatttgatgataaaggctcgctaatttct
ttctctcgttttggtacagtaggtagtctaatggggaatttaactaaaggctcaatgttt
attgaagggaagatcgcccgtatggcatacctttctctttatcgtatgcaccaagtggct
ctacacggttgtgtcaaaacagggttgattatgttggttggtagaattaatcgtttttta
agaccaacgatgaagttgcattaa

DBGET integrated database retrieval system