KEGG   Glaesserella parasuis ZJ0906: K756_11355Help
Entry
K756_11355        CDS       T02697                                 

Definition
(GenBank) ISAma3, family ISAs1
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-GeneID: 16165655
NCBI-ProteinID: AGO17362
Position
2183407..2183742
Genome map
AA seq 111 aa AA seqDB search
MLEVCRKRSDNGKESQEKVFYISSLDVDIQILAKCVRGHWEVENKAHWVLDVVYKEDECA
VTDEWGAENLAILRRLALNLARLHPKKQSMKGKLTAAGWSDEFRDELLLGV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgttggaggtgtgtcgcaagcggtcagataatggcaaagaatcacaagaaaaagtcttt
tatatcagtagtttggatgttgatattcaaatattggcgaagtgtgtgcgagggcattgg
gaagtggaaaacaaagcccattgggtgctagatgtggtctataaagaagacgaatgtgct
gtgaccgatgaatggggtgcggaaaatctggcaattttgcgtcgattagcgttgaacttg
gctcgattacacccgaaaaagcagagtatgaaagggaaattgaccgctgctggttggtca
gatgaatttcgagatgagctgttgctcggtgtgtag

DBGET integrated database retrieval system