KEGG   Glaesserella parasuis ZJ0906: K756_11370Help
Entry
K756_11370        CDS       T02697                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    K756_11370 (acpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50
Motif
Other DBs
NCBI-GeneID: 16166934
NCBI-ProteinID: AGO17365
Position
2189892..2190122
Genome map
AA seq 76 aa AA seqDB search
MSIEERVKKIIVDQLGAKAEDVKPETSFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KIATVQSAIDYVQNNQ
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagaacgcgtaaaaaaaattatcgttgatcaacttggtgcaaaagcagaa
gatgtaaaaccagaaacttctttcattgaagatttaggtgcagactctcttgacactgtt
gagttagtgatggctttagaagaagaattcgatatcgaaattccagatgaagaagcagaa
aaaatcgctactgttcaatctgcgattgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system