KEGG   Glaesserella parasuis ZJ0906: K756_11400Help
Entry
K756_11400        CDS       T02697                                 

Definition
(GenBank) ISHin1, family IS3
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_28 HTH_Tnp_1 BrkDBD
Motif
Other DBs
NCBI-GeneID: 16165603
NCBI-ProteinID: AGO17371
Position
complement(2194726..2194872)
Genome map
AA seq 48 aa AA seqDB search
MAKYTQSFKQQVIEFYLQHNKNRSLTRQHFQVKETILRYWINQYNHTS
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatacacccaatcttttaaacaacaagtgatcgaattttatcttcaacataat
aaaaatcgctcattaactcgtcagcattttcaggttaaggaaaccatattaagatattgg
attaatcagtataatcacacctcgtga

DBGET integrated database retrieval system