KEGG   Glaesserella parasuis ZJ0906: K756_11405Help
Entry
K756_11405        CDS       T02697                                 

Definition
(GenBank) acetyltransferase
  KO
K03823  phosphinothricin acetyltransferase [EC:2.3.1.183]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00440  Phosphonate and phosphinate metabolism
hpaz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    K756_11405
Enzymes [BR:hpaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.183  phosphinothricin acetyltransferase
     K756_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 16166610
NCBI-ProteinID: AGO17372
Position
complement(2194980..2195129)
Genome map
AA seq 49 aa AA seqDB search
MFRLAQQDDLTRILEIYNQVIERRTVTADLVPATKESRQTWFNQQSKSC
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcctagcacaacaagatgatttaactcgaattcttgaaatttataaccaggtg
attgaaagacgcacagtgacggcagatttagttccagcaacgaaggaaagccgccaaacg
tggtttaatcagcaatctaaatcatgctaa

DBGET integrated database retrieval system