KEGG   Glaesserella parasuis ZJ0906: K756_11410Help
Entry
K756_11410        CDS       T02697                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00230  Purine metabolism
hpaz00240  Pyrimidine metabolism
hpaz01100  Metabolic pathways
hpaz03030  DNA replication
hpaz03430  Mismatch repair
hpaz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    K756_11410
   00240 Pyrimidine metabolism
    K756_11410
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    K756_11410
   03430 Mismatch repair
    K756_11410
   03440 Homologous recombination
    K756_11410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hpaz03032]
    K756_11410
   03400 DNA repair and recombination proteins [BR:hpaz03400]
    K756_11410
Enzymes [BR:hpaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     K756_11410
DNA replication proteins [BR:hpaz03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     K756_11410
DNA repair and recombination proteins [BR:hpaz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     K756_11410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-GeneID: 16166082
NCBI-ProteinID: AGO17373
Position
complement(2195138..2195575)
Genome map
AA seq 145 aa AA seqDB search
MKQVQFYLLSQAQAGELSAQEALACDLAAKAWRQGKRVLIACETEEQAFSLDEALWAREA
DDFVPHNLSGEVTTYATPIEISWKGKRNAQRRDVLISLQTELPNFINSFNQIIDFVSVDE
TEKVQARERYKQYRQLGWQLSTEQV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaagtacaattctatctattaagccaagcccaagcaggcgaactttccgctcaa
gaagctctagcgtgcgatttagcggcaaaagcgtggcgacaaggtaaacgagtgctgatt
gcttgtgaaaccgaagaacaggcattcagccttgatgaagcactttgggcaagagaagcg
gatgattttgtaccacataatctgtccggcgaagtcaccacctatgcgaccccgattgaa
atttcgtggaaaggcaaacgcaatgcccaacgccgagatgtattgatttcattacaaaca
gaattacccaattttattaacagctttaatcaaattattgatttcgtgtcggttgatgaa
acagaaaaggtccaagcgagggaacgttataaacaatatcgccaactaggttggcagtta
agtaccgagcaagtttaa

DBGET integrated database retrieval system