KEGG   Glaesserella parasuis ZJ0906: K756_11450Help
Entry
K756_11450        CDS       T02697                                 

Definition
(GenBank) ABC transporter permease
  KO
K02026  multiple sugar transport system permease protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Module
hpaz_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpaz02000]
    K756_11450
Transporters [BR:hpaz02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    K756_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 16165509
NCBI-ProteinID: AGO17379
Position
2202975..2203808
Genome map
AA seq 277 aa AA seqDB search
MKKKSSLFGDIVSHLFLATSTVIAIFPLVWIFISSVKSKGELTSEPTRFWPKIFTLDYFE
HVINDLNFIVNIKNSLFISLVTTIIAITISAMAAYGIVRFFPKLGSIMSRLLVTTYIFPP
ILLAIPYSIAMAKAGLTNTTSGLIIVYLSFSVPYAVWLLVGFFQTVPIEIEEAAKIDGAG
KFTIFFKIVLPLVAPGIVATAIYTFINAWNEFLYALILVNDTSKMTVAVALRSLNGAEIL
DWGDMMAASVIVVIPSVLFFCFIQNKIAGGLSEGSVK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatcttcattatttggcgacatcgtttcccatcttttcttagcaacttca
acggtcattgctatctttcctttggtatggatattcatttcgtccgtaaaaagtaaaggg
gaactcaccagtgagccaactcggttctggccgaagatattcacactagattactttgaa
cacgttattaacgatctcaacttcattgtgaatattaaaaacagtctatttatctcgcta
gttacgaccattatcgccatcaccatttcggcaatggcagcatacggtattgttcgtttc
ttcccgaaattaggctcgattatgtcaagattattggtcacaacctacattttcccaccg
attttacttgccattccatactctatcgcaatggcaaaagcagggctaaccaatacaaca
agcggtctgatcatcgtctatctttccttcagcgtaccttatgcagtttggttgctagtt
ggattttttcagactgtaccgattgaaattgaagaagccgccaaaattgatggagcgggt
aaattcaccatcttcttcaaaattgtcttaccacttgtggcaccgggtattgttgcaact
gccatttacacctttatcaatgcgtggaatgagttcttatacgcccttattctcgtcaat
gataccagcaaaatgacagttgccgtggcattacgatctctaaatggtgcagagatccta
gattggggcgatatgatggcggcttcggttattgtggtcattccatcagtattattcttt
tgttttattcaaaataaaatcgcaggaggattatctgaaggctcagttaaataa

DBGET integrated database retrieval system