KEGG   Glaesserella parasuis ZJ0906: K756_11455Help
Entry
K756_11455        CDS       T02697                                 

Definition
(GenBank) KpLE2 phage-like element; oxidoreductase
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C Semialdhyde_dh Sacchrp_dh_NADP 2-Hacid_dh_C F420_oxidored NAD_binding_2 TrkA_N NAD_binding_7 Pyr_redox CoA_binding
Motif
Other DBs
NCBI-GeneID: 16165186
NCBI-ProteinID: AGO17380
Position
2203869..2204972
Genome map
AA seq 367 aa AA seqDB search
MIRYGVVGVGYFGADLARFMNEFDNAQITVVYDPENGQTIAEELKCDAANSLEELVTRDD
VDCVIVATPNYLHKEPVILAAKHKKHVFCEKPIALSYQDCDEMVKACEENGVTFMAGHVM
NFFNGVHHAKELINQGVIGKVLYCHTARNGWEDVQPSISWKKIREKSGGHLYHHIHELDC
VQFLMGGMPKSVYMNAANVAHNTPEFGDEDDMLFVNLEFDDNRFAVLEWGSAFRWGEHYV
LIQGTKGAIKLDMYHCKGILRLDGKESYFLVHESQEEDDDRTRIYTSTEMDGAIQYGKPG
KRTPMWLSSIMKKEMKYLNDILHGMQPNEEFIKLLTGEAARAAIATADACTLSVREKRRV
ELSEIIH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattagatatggtgttgttggcgtgggctattttggtgcagatctcgcacgctttatg
aatgaatttgataatgcacaaattacggtggtttacgacccagaaaacggacaaaccatc
gcagaagaattgaaatgtgatgctgcaaatagcttggaagaattagtaacgcgtgatgat
gtagattgtgtcattgtcgccacaccaaactatttacataaagaacccgttattttggct
gcaaaacataaaaaacacgttttctgtgaaaaacctatcgcattaagttatcaagattgt
gacgagatggtcaaagcctgcgaagaaaacggcgttacttttatggcaggacacgttatg
aatttctttaacggtgttcatcatgctaaagagctgattaatcaaggtgttataggtaaa
gtgctatattgccataccgctcgcaatggctgggaagatgtgcaaccaagtatttcgtgg
aaaaaaattcgtgaaaaatcgggcggacatttatatcaccatatccacgagctagattgc
gttcaattcttaatgggtggaatgccaaaatcagtttatatgaatgcagcaaacgttgct
cacaatacccctgagtttggtgatgaagacgatatgttatttgtcaatttggaatttgat
gataaccgctttgctgtattggaatggggatcagccttccgttggggagaacactatgtg
ttaattcaaggcacaaaaggggcaatcaaactggatatgtatcattgcaaaggcatatta
cgtcttgatggcaaagagagttatttcttagtccacgaaagccaagaagaagatgatgat
agaacgcgtatttataccagtaccgaaatggacggtgcaatccaatacggtaaaccagga
aaacgcaccccaatgtggttaagttccattatgaaaaaagagatgaaatatctgaatgat
attttacacggtatgcaaccaaatgaagagtttataaaactactcacaggtgaagccgca
agagctgcaattgcaaccgcagacgcctgtacgctttctgtaagggaaaaacgtcgggtt
gagttaagtgaaattattcattaa

DBGET integrated database retrieval system