KEGG   Glaesserella parasuis ZJ0906: K756_11495Help
Entry
K756_11495        CDS       T02697                                 

Definition
(GenBank) DoxX family protein membrane protein
  KO
K15977  putative oxidoreductase
Organism
hpaz  Glaesserella parasuis ZJ0906
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    K756_11495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX DoxD DoxX_2
Motif
Other DBs
NCBI-GeneID: 16167317
NCBI-ProteinID: AGO17388
Position
2210154..2210570
Genome map
AA seq 138 aa AA seqDB search
MNNFFEKLAQTFSPYILLITRVLVGYMFLLHGTAKFFELPISMTGGNGAVPLFSLFGVAG
VLEIVGGILLILGLFTRATAFILAGQMAVAYFIFHAASGAIFDPISNKGEAAALFSMAFL
LLWHSGAGKLSLDAKLGK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacttctttgaaaaattagcacaaactttcagtccatatatcctattaatcact
cgtgtattagtcggttatatgtttttacttcatggcaccgcaaaattctttgagttaccg
atttcaatgacaggcggcaatggtgcggtaccactcttttctctgtttggtgtagcaggt
gtattagagattgttggcggtatcttgttgattttaggtttatttacccgtgcaacagca
tttattctagcaggacaaatggcagtagcctattttatattccacgctgcttcaggggcg
attttcgatccaattagtaacaaaggcgaagctgctgcattatttagtatggcattctta
ttattgtggcatagtggtgcaggtaaattatctcttgatgcgaaattaggaaaataa

DBGET integrated database retrieval system