KEGG   Glaesserella parasuis ZJ0906: K756_11570Help
Entry
K756_11570        CDS       T02697                                 

Definition
(GenBank) hypothetical protein
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 16166116
NCBI-ProteinID: AGO17401
Position
2223358..2223828
Genome map
AA seq 156 aa AA seqDB search
MQLRLACAELMEKQGHLGPTGQAKITPAFNLPSAYVLHTVGPIISGALSAKDCELLASCY
RSCLELAKQHGIESVAFCCISTGEFRFPNQEAAEIAVQTVKAFLADNPQMKVVFNVFKDV
DLEIYRGLLGELIKSAVKFPQIFTIAKSIRNPTACN
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttcgccttgcttgtgctgaattgatggaaaaacaagggcatttgggacccaca
gggcaagcaaaaatcaccccagcatttaacttgccgtctgcctacgttttgcacactgtg
gggccgattatcagtggtgcgttatcggcaaaagattgcgaactgctcgccagttgctac
cgctcttgcctagaactcgccaagcaacacggtattgagagtgtcgccttttgttgcatc
agcacgggcgaatttcgtttccctaatcaagaggcagcagaaatcgccgtgcaaactgtc
aaagcctttttagccgataacccgcaaatgaaggtagtgtttaatgtgtttaaagatgtg
gatttagagatttatcgggggctgttgggggagttgataaaaagtgcggtcaaatttcca
caaatttttacaattgcaaaatccataagaaatcccaccgcttgcaattag

DBGET integrated database retrieval system