KEGG   Glaesserella parasuis ZJ0906: K756_11575Help
Entry
K756_11575        CDS       T02697                                 

Definition
(GenBank) HxlR family transcriptional regulator
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_12 HTH_34 PadR MarR Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 16166430
NCBI-ProteinID: AGO17402
Position
complement(2223829..2224194)
Genome map
AA seq 121 aa AA seqDB search
MEKFSNSIERGYVLSAQCPSREILQHLTNRWGVLVMIVLMKGTKRFSEIRREIDGVSERM
LTQTLQQLEQDGMLNRKSYNTVPPHVEYSLTDFGLQAGSRLVDLVDWLEENLNGILKSQK
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattttcaaattcaatcgaacggggttatgtattatccgctcaatgcccttct
cgtgagattttgcaacatctgactaaccgttggggcgtgttggtgatgattgtgttgatg
aaaggcacaaaacggtttagcgaaatccgccgtgagattgacggcgtgagcgaacgtatg
ctgacccaaacgctacaacagttggaacaagatggtatgctcaatcgtaaatcctacaac
accgttccgccacacgttgaatattcgctgacggattttggcttacaggctggcagtcgc
cttgtggatttggtggactggttggaagagaatttgaatgggattttgaaaagccaaaag
aaatag

DBGET integrated database retrieval system