KEGG   Glaesserella parasuis ZJ0906: K756_11595Help
Entry
K756_11595        CDS       T02697                                 

Definition
(GenBank) D-ribose ABC transporter substrate-binding component RbsB
  KO
K10439  ribose transport system substrate-binding protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz02010  ABC transporters
hpaz02030  Bacterial chemotaxis
Module
hpaz_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    K756_11595
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    K756_11595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpaz02000]
    K756_11595
Transporters [BR:hpaz02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    K756_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 TPP_enzyme_N PA ABC_sub_bind Dr_adhesin
Motif
Other DBs
NCBI-GeneID: 16166545
NCBI-ProteinID: AGO17404
Position
complement(2225457..2226404)
Genome map
AA seq 315 aa AA seqDB search
MKKLAIVTTTVLGLSTLFAGLAWAKSDEIAVIVKSANSTFWQNVRKGAETAGADLGGKYK
VTFQGPESETAIDAQVNMVDNAVNRGVAGIVLAASDPVALVPAVRKAYESGIPVVLIDSG
LNSDGKYYQSFLATDNRAAGKLAAEKLLAKVKGGKVAVMSFTQGAASAIERTGGFIDEVK
SKADYKIVGPYYSNSEMVTALNQTEDVLGSNPDIAAIFGANEPTAVGMARAVKQKGFAGK
IVAVGFDGNSDLQNFVRDGTLDGIVVQSSYQMGYKGVDTIGKIIKGEKVEKVIDTGVVYV
TKENIDSPEAKAVLY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaatcgtaaccacaactgtattaggtttatctaccctttttgcaggc
ttagcgtgggcaaaatcagacgaaattgcagtcatcgtaaaatccgctaactcaactttc
tggcaaaacgtacgtaaaggtgcagaaactgcaggtgcagatttaggcggaaaatataaa
gtgaccttccaaggccctgaatcagaaactgcgattgacgcacaagtcaatatggtggac
aacgctgtgaaccgtggtgttgcaggtattgtgcttgcggcttctgacccagtggctctt
gtgccagcagtgagaaaagcctatgaaagcggtattccagtggtattaatcgactcaggc
ttaaacagcgatggtaaatactatcaatcattccttgcaaccgataaccgtgctgcaggt
aaattagccgctgaaaaattattagctaaagtgaaaggcggtaaagtggcagtgatgtca
ttcacccaaggtgcagcttctgcgattgaacgtacaggcggcttcattgatgaagtgaaa
tctaaagcagattacaaaattgttggtccatactactcaaattcagaaatggttaccgca
ttgaaccaaactgaagacgtgttaggttctaaccctgatattgcggcgatcttcggcgca
aacgaaccgaccgcagtgggtatggctcgtgctgtgaaacaaaaaggcttcgcaggtaaa
atcgttgccgttggttttgatggtaactcagaccttcaaaacttcgtccgtgacggaact
ttagacggtatcgtggtgcaatcttcataccaaatgggctacaaaggtgttgatactatc
ggcaaaattattaaaggtgaaaaagtcgagaaagttattgatactggtgtagtttatgta
acaaaagaaaacatcgactctccagaagcgaaagcggtactttactaa

DBGET integrated database retrieval system