KEGG   Glaesserella parasuis ZJ0906: K756_11615Help
Entry
K756_11615        CDS       T02697                                 

Definition
(GenBank) hypothetical protein
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF986 PAP2_3
Motif
Other DBs
NCBI-GeneID: 16166773
NCBI-ProteinID: AGO17408
Position
complement(2230409..2230867)
Genome map
AA seq 152 aa AA seqDB search
MTNILLILAIGLSLLYILYDQLIMDRRNGETRLSVPLIRQASLDTGILIALIVLIIVQGV
QTGIEPLTVFLLCGCIVLAVYSAFIRYPRLLLKEQGFFFGNFYFLYSHIAQINLADQNIL
VIDLKNNRRLFIRIKQKEDIERVVNFFGGYKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatatacttctgattttagctattggtttgagcttgctctatattctctatgat
cagctcattatggacagacgaaacggcgaaacccgactaagtgtgccgttaattcgacaa
gcaagtttagacaccgggattttaattgccctaattgtgttaattatcgtacaaggagtg
caaacaggtattgaacctctcactgtattcttattatgcggttgtattgtcttagcagtc
tattcggcgttcattcgttaccctcgtttactattaaaagaacaaggctttttctttggc
aatttctattttttatatagccatattgcacaaattaatttggcagatcagaatatttta
gtcattgatctaaaaaataataggcgattgtttattcggattaaacaaaaagaagatatt
gaacgagttgtcaatttctttggaggatacaaaaaatga

DBGET integrated database retrieval system