KEGG   Glaesserella parasuis ZJ0906: K756_11635Help
Entry
K756_11635        CDS       T02697                                 

Definition
(GenBank) protoheme ferro-lyase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00860  Porphyrin and chlorophyll metabolism
hpaz01100  Metabolic pathways
hpaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    K756_11635
Enzymes [BR:hpaz01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     K756_11635
    4.99.1.9  coproporphyrin ferrochelatase
     K756_11635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase CbiX
Motif
Other DBs
NCBI-GeneID: 16166817
NCBI-ProteinID: AGO17412
Position
complement(2233905..2234870)
Genome map
AA seq 321 aa AA seqDB search
MNKSKKIGVLLANLGTPDEPTTPAVKRYLRQFLSDPRVIDLPKWRWKFILNCLVLPKRVP
KVAQAYKTIWTEDGSPLLSISRQQQAAIQTYFCSQNNNIVIELGMSYGNPSIQSAVDSLI
AQDVEKIIILPLYPQYSSTTTASVLDAFAQALYKHKKVLPFEFIHNYHNHPLYIKALANT
VTLTENELLLFSFHGIPARYEAEGDFYSEQCRETARLVAKELNLTENQWLLSFQSRFGSE
EWLQPYTDELLSNLPTKNIKNIAVICPGFAADCLETIEEIAEENQENFKNAGGNNYRYIS
ALNANSDHISFLVKLIESKLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaaaaaaaattggtgtgctattagcaaacttaggcactcctgatgaacca
actactccggcagtgaaacgttacttaagacaattcctgagcgatccaagagtaattgat
ttaccgaagtggcgttggaaatttattttgaactgtcttgtgttacctaaaagagtacct
aaagttgcacaggcttataaaactatctggacagaagatggctctcctttattatctata
tctcgtcaacagcaagccgctattcagacttatttttgctcacagaacaacaatattgtc
attgaacttggaatgagttacggtaatcctagtatccagagtgctgttgatagccttata
gcacaggatgtagaaaaaattattatacttccactctaccctcaatatagctcaacaaca
acagcctcagtgctggatgcttttgcacaagcattatataaacacaagaaagttttgcct
tttgaatttattcacaattaccataatcaccctttgtatattaaagcattagcaaatact
gtaacgcttacagagaatgagctattacttttttctttccacggtatacctgctcgttat
gaagcagaaggtgacttttattcagaacaatgccgagaaactgcccgtttagtagccaag
gagctcaatttgacagaaaatcaatggcttttatctttccaatctcgttttggtagtgaa
gagtggcttcaaccttataccgatgaacttttatcgaatcttcctactaaaaatataaaa
aacatagcggttatttgtcctggttttgccgcagattgccttgaaacaattgaagaaatt
gctgaagaaaatcaggaaaattttaaaaatgcaggaggaaataactacagatatatttca
gcattgaatgcaaatagcgatcatattagctttttagttaagttgattgagtcaaagcta
gactga

DBGET integrated database retrieval system