KEGG   Glaesserella parasuis ZJ0906: K756_11650Help
Entry
K756_11650        CDS       T02697                                 

Definition
(GenBank) addiction module killer protein
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp49
Motif
Other DBs
NCBI-GeneID: 16167083
NCBI-ProteinID: AGO17415
Position
2239831..2240136
Genome map
AA seq 101 aa AA seqDB search
MYIIEQTETFKLWLNELKDPIAKIAIIRRLERAKNGHFGDHKSLGDGIYEMRLMINKGYR
IYYARKGEIIYLIINGGYKDIQEQDIAVAKRFWQQYQLEQE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtacattattgaacaaactgaaacctttaaattatggctaaatgaactcaaagatcct
attgcaaaaattgcgattatccgtcgcttagaacgagcaaaaaacggacattttggagat
cataagtcgctaggtgacggcatttatgaaatgcgattgatgataaacaaaggctaccgt
atctactatgcaagaaaaggggaaatcatctatctcattatcaacggcggatacaaagac
atccaagagcaagacatcgccgtagcaaaaagattctggcaacaataccaacttgaacag
gaataa

DBGET integrated database retrieval system