KEGG   Glaesserella parasuis ZJ0906: K756_11655Help
Entry
K756_11655        CDS       T02697                                 

Definition
(GenBank) putative transcriptional regulator
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_26 RPT TetR_N HTH_7
Motif
Other DBs
NCBI-GeneID: 16167104
NCBI-ProteinID: AGO17416
Position
2240143..2240448
Genome map
AA seq 101 aa AA seqDB search
MKDKSFNGQISTFDAAEYLNNDELIALYLSEVLKDGDEAEFIQALNTIARAKGMNELAKK
ANIGRESLYQTLSSKKPRFETIVKILSALNIELVPKVKTTQ
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaatcgtttaacggacaaatatcaacgttcgatgctgctgagtatctcaat
aacgatgaacttatcgcactttatctatcggaagtgctaaaagacggtgatgaagccgaa
ttcattcaagcgttaaataccattgcccgtgcaaaaggaatgaatgaattagccaaaaaa
gccaatatcggtagagaaagtttatatcaaacactttcaagcaaaaaaccacgttttgaa
accattgtgaaaattctttcagcgttaaatattgagctagtgcctaaggttaaaactacc
caatag

DBGET integrated database retrieval system