KEGG   Glaesserella parasuis ZJ0906: K756_11660Help
Entry
K756_11660        CDS       T02697                                 

Definition
(GenBank) hypothetical protein
Organism
hpaz  Glaesserella parasuis ZJ0906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HicA_toxin
Motif
Other DBs
NCBI-GeneID: 16167081
NCBI-ProteinID: AGO17417
Position
2240590..2240865
Genome map
AA seq 91 aa AA seqDB search
MRKKHQQTLYAIFATPTSSNIKWKEIESLIEGLGGEIIQGEGSRVRFKLNNSIARFHRPH
PSPDTDKGAIANLREWLTKIGITPNGNKTTT
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagaaacatcagcaaacactttatgctattttcgcaacaccaacatcatctaat
atcaaatggaaagagatagaatctctgattgaagggttaggtggtgagattattcaaggt
gaaggctctagagtacgatttaaactaaacaatagcattgctcgttttcatcgtccacac
ccatcaccagatacggataagggtgctatcgcaaacttgcgtgaatggcttactaaaata
ggaattactccaaatggcaacaaaacaacaacctaa

DBGET integrated database retrieval system