KEGG   Glaesserella parasuis ZJ0906: K756_11685Help
Entry
K756_11685        CDS       T02697                                 

Definition
(GenBank) periplasmic solute-binding protein
  KO
K07082  UPF0755 protein
Organism
hpaz  Glaesserella parasuis ZJ0906
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    K756_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG ANT Phage_terminase
Motif
Other DBs
NCBI-GeneID: 16167028
NCBI-ProteinID: AGO17422
Position
complement(2244809..2245843)
Genome map
AA seq 344 aa AA seqDB search
MLKKILISLGLLSVIALGGGIYVYQKLNLLAEHKLTVKPEQLFVLEKGTSSQKLAQLLAE
QGIIHRDDVELLPYLIRLNPKLSKFKAGVYALDNIATVKELLQHFNSGKEVQLNVQFIEG
KTFKTWREQLAKARYLEQTLTDKTEADIAKLLGITQDKLEGWLAPDTYSYVPYSKDIDVL
KRAYQKQQKALEQAWQNRAENLPLKTPYEMLILASIVEKETGVANERPQVASVFINRLKN
GWKLQADPTVIYGMGDKYDGNIRKKDLLEPTPYNTYVIDGLPPTPIAMPSEASIKATAQP
DSTPYFYFVADGSGGHKFSRTLDEHNKAVREWIQIERNKKSENK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaattcttatttctcttgggcttttatctgttattgcccttggcggtggc
atttatgtttaccagaaactcaatctgttagctgaacataaattaaccgttaaacctgag
caactgtttgtgttggaaaaaggtacatcaagccaaaaactcgctcagctattagcagag
caaggcattattcatcgtgatgatgtggagctattaccctatttgatccgccttaaccct
aaactcagtaaatttaaggctggggtttatgcgttagataatatcgctacggtgaaagag
ctgttgcaacatttcaatagcggtaaagaagtgcagttaaatgtgcaatttattgaagga
aaaacctttaaaacgtggcgtgagcagttggcaaaggctcgctatttagaacaaactttg
acggataaaacagaggctgacattgctaaactattgggaatcactcaggataaattggaa
ggttggcttgcccctgatacttatagctatgtgccttattccaaagatattgatgtgctt
aaacgtgcctatcaaaaacagcaaaaggcgttggaacaggcttggcaaaatagggcagaa
aacctaccgcttaaaacgccttatgaaatgctaattttggcttcgattgtcgaaaaagaa
acgggcgtggcgaatgagcgtccgcaagtggcatcggtatttatcaaccgcttgaaaaat
ggctggaaattgcaggccgatccaacggtcatttacggtatgggcgataaatatgatggc
aatatccgtaagaaagatctgcttgaacctactccttataatacttatgtgattgatggt
ttgccgccgacaccgattgcaatgccgagcgaagcgtcaattaaggcgacggcacagcct
gacagtacgccttatttctattttgtggcggacggttctggtgggcataaattcagccgt
actttagatgagcataataaagcggtgcgagaatggatccaaattgagcgaaataaaaag
agtgagaacaaataa

DBGET integrated database retrieval system