KEGG   Helicobacter pylori B38: HELPY_0112Help
Entry
HELPY_0112        CDS       T00950                                 

Definition
(GenBank) Putative L-fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00051  Fructose and mannose metabolism
hpb01100  Metabolic pathways
hpb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HELPY_0112
Enzymes [BR:hpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HELPY_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CAX28665
UniProt: C7BXP1
Position
113752..114390
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIYSLKSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASQDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgatttattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttca
gcacgcattggcactaaccaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
caggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcgcgtcctccttatagtttggcgtattccttgcgccacaaccgattgctccctaga
gattatttggggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaatcttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagggagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system