KEGG   Helicobacter pylori B38: HELPY_0282Help
Entry
HELPY_0282        CDS       T00950                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01130  Biosynthesis of antibiotics
hpb01230  Biosynthesis of amino acids
Module
hpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELPY_0282
Enzymes [BR:hpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HELPY_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAX28826
UniProt: C7BYL6
Position
274793..275293
Genome map
AA seq 166 aa AA seqDB search
MLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLEKLLKENTHTDCVIVNFKGLYEIG
VPSVFDLEVLGLLRRYANSLIVHQDLFISHYQLLESLVQGSDGVILDEELLKEDLKGMVE
FSWRLGLSVFVETHKPDYTHLKDLGVLGVLENSPHSYNQKKIVFLD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcccagagtc
attcctcaaattaaagattgtgtttttgtaacccctgatgaggttttagaaaagcttttg
aaagaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggc
gtgccaagcgtgtttgatttagaagttttagggttattgcgccgctatgcgaactctttg
attgtccatcaagatcttttcatcagccattaccagcttttagaatcccttgttcaagga
tctgatggggtcattttagatgaagagcttttaaaagaggatttaaagggcatggtagaa
ttttcttggcgtttgggcttgagcgtgtttgtagaaacccataagccagactacacccat
ttaaaagatttaggggttttaggcgtgttggaaaatagcccccattcttataatcaaaaa
aaaatagtctttttagattga

DBGET integrated database retrieval system