KEGG   Helicobacter pylori B38: HELPY_0683Help
Entry
HELPY_0683        CDS       T00950                                 

Definition
(GenBank) Putative acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00071  Fatty acid degradation
hpb00072  Synthesis and degradation of ketone bodies
hpb00280  Valine, leucine and isoleucine degradation
hpb00310  Lysine degradation
hpb00362  Benzoate degradation
hpb00380  Tryptophan metabolism
hpb00620  Pyruvate metabolism
hpb00630  Glyoxylate and dicarboxylate metabolism
hpb00640  Propanoate metabolism
hpb00650  Butanoate metabolism
hpb00900  Terpenoid backbone biosynthesis
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01120  Microbial metabolism in diverse environments
hpb01130  Biosynthesis of antibiotics
hpb01200  Carbon metabolism
hpb01212  Fatty acid metabolism
hpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HELPY_0683
   00630 Glyoxylate and dicarboxylate metabolism
    HELPY_0683
   00640 Propanoate metabolism
    HELPY_0683
   00650 Butanoate metabolism
    HELPY_0683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HELPY_0683
   00072 Synthesis and degradation of ketone bodies
    HELPY_0683
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HELPY_0683
   00310 Lysine degradation
    HELPY_0683
   00380 Tryptophan metabolism
    HELPY_0683
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HELPY_0683
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HELPY_0683
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HELPY_0683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpb04147]
    HELPY_0683
Enzymes [BR:hpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HELPY_0683
Exosome [BR:hpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HELPY_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAX29213
UniProt: C7BZB5
Position
complement(660175..661350)
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKNVGAREMGVCVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMST
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagaatgtgggcgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agcggccttaagcctagcgatgtggattccgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccaggcagatccaactagacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttggtcgcgatgaggtggtggtgtgcggtggcgtggagaacatgagcacg
gcaccctatctgtcgtttgacatgcgagatgggaaaagaatggggaatgctaacatgata
gactccatgatacatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgttgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcggggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gatacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcact
caaaaagcgcaaaaattggggttaaaaaccatggccactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatccatctttttgaactcaatgaagctttcgccgcg
caaagtctagccgtgttaaaagagcttgaattaaaccccaatatagtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatcttagtaactctg
ttgcatgaaatgaagaggagcgggcatggcgtgggttgcgcgtcattgtgtgtgggcggc
gggcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system