KEGG   Helicobacter pylori B38: HELPY_1011Help
Entry
HELPY_1011        CDS       T00950                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00450  Selenocompound metabolism
hpb00970  Aminoacyl-tRNA biosynthesis
hpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HELPY_1011 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HELPY_1011 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpb01007]
    HELPY_1011 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpb03016]
    HELPY_1011 (metS)
Enzymes [BR:hpb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HELPY_1011 (metS)
Amino acid related enzymes [BR:hpb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HELPY_1011 (metS)
Transfer RNA biogenesis [BR:hpb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HELPY_1011 (metS)
 Prokaryotic type
   Other AARSs
    HELPY_1011 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e CCDC53 SAC3_GANP
Motif
Other DBs
NCBI-ProteinID: CAX29525
UniProt: C7BXA6
Position
complement(1000076..1002028)
Genome map
AA seq 650 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGA
YSGYYCVSCESYCAISKADNTNDKVLCPDCLRETTLLEEESYFFKLSAYEKPLLEFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLDNKMAHFECARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYSKELEKAHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAAKLASAFHAEI
TPDNYERFFKAKKLQDMILQDTEPLFSKMEKIEKAEKAGEASPEKNEKEKKDRKEKAPPK
QENYIGIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGEGRLRQIISGIALDYEPESL
VGQMVCVVANLKPAKLMGEMSEGMILAVRDNDNLALISPTREKIAGSLIS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggc
catgcttatacgactttgattgcggacactttaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgaga
ttgagaaatcaaagccctaaagcttacgctgatagcattagtgcgatttttaaaaaccag
tgggattttttcaatttggattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcgct
tatagtgggtattattgcgtgagctgtgagagttattgcgcgatttctaaagcggacaat
acgaacgataaagtcctatgccctgattgcttgagagaaaccacgcttttagaagaagag
agctattttttcaaattgagcgcgtatgagaagcctttattggagttttacgctaaaaac
cctgaagcgattttgcctatttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctttctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgttagggtatttgaatggtttagacaataaaatggcgcattttgaatgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccggcttttttgatgagt
ttgaatctgcccttattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaaaagcttgggtaatgttttagacgctcaaaagctcgctatggagtatggg
attgaggaattacgctattttttattgcgtgaggtgccttttggacaagatggggatttt
tctaaaaaagcgttagtagaaagaatcaacgcgaatttgaacaacgatttggggaatttg
ctgaatcgcttgctaggcatggctaaaaaatatttcaattattctctaaaaagtgcaaaa
atcaccgcttattattctaaagagctagaaaaagcgcatcaaatcttggataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaacgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcacaaaaacaacgaatca
gaaaaattagaagccttattgagtttgatcgcaaacgcgcttttacaatcaagctttttg
ctttatgcgttcatgccaaagagcgcggctaaattagcgagcgcttttcatgcagaaatc
acgcccgataattacgaacgcttttttaaggctaaaaaattacaagatatgattttacaa
gacaccgaacctttattttccaaaatggagaaaattgaaaaggctgaaaaagcgggagaa
gcctcaccagaaaaaaacgaaaaagaaaaaaaagatagaaaagaaaaagccccaccaaaa
caagaaaactatatcggcattgaggatttcaaaaaagtagagatcaaagtggggcttatc
aaagaagctcaaaggattgaaaaatccaataaattactgcgtttaaaagtggatttaggc
gaaggccgtttgaggcagattatttcagggatcgctttggattatgagcctgaaagtttg
gtggggcaaatggtgtgcgtagtggctaatttaaagcctgcaaagcttatgggcgaaatg
agtgagggcatgattttagcggtgcgagataatgataatctggctttaatcagccctacc
agagaaaaaatcgcaggaagtttgatcagctaa

DBGET integrated database retrieval system