KEGG   Helicobacter pylori B38: HELPY_1078Help
Entry
HELPY_1078        CDS       T00950                                 

Gene name
porD
Definition
(GenBank) Pyruvate synthase subunit porD (Pyruvate oxidoreductase delta chain) (POR) (Pyruvic-ferredoxin oxidoreductase delta subunit)
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00010  Glycolysis / Gluconeogenesis
hpb00020  Citrate cycle (TCA cycle)
hpb00620  Pyruvate metabolism
hpb00640  Propanoate metabolism
hpb00650  Butanoate metabolism
hpb00680  Methane metabolism
hpb01100  Metabolic pathways
hpb01120  Microbial metabolism in diverse environments
hpb01130  Biosynthesis of antibiotics
hpb01200  Carbon metabolism
Module
hpb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELPY_1078 (porD)
   00020 Citrate cycle (TCA cycle)
    HELPY_1078 (porD)
   00620 Pyruvate metabolism
    HELPY_1078 (porD)
   00640 Propanoate metabolism
    HELPY_1078 (porD)
   00650 Butanoate metabolism
    HELPY_1078 (porD)
  Energy metabolism
   00680 Methane metabolism
    HELPY_1078 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HELPY_1078 (porD)
Enzymes [BR:hpb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HELPY_1078 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CAX29600
UniProt: C7BZI9
Position
1076265..1076657
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaacgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcccgctaccgcactcactcaa
tggccacaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system