KEGG   Helicobacter pylori PeCan4: HPPC_02655
Entry
HPPC_02655        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein (cagM, cag16)
  KO
K12101  cag pathogenicity island protein 16
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02655
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02655
SSDB
Motif
Pfam: G0-G1_switch_2
Other DBs
NCBI-ProteinID: ADO06769
UniProt: E1Q626
Position
523305..524435
AA seq 376 aa
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLED
LIFRKQKIKELVDHRAKVLSDLENKYKKEKEALEKETRGKILAAKSKAYGDLEQALKDNS
LYKKLLPNPYAYVLNQETFTKEDKERLSYYYPQVKNSNIFKKTTATTKDKAQALLQMGVF
SLDEEQNKKASRLALSYKQAIEEYSNNISNLLSRKELDNIDYYLQLERNKFDSKAKDIAQ
KATNALIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNVKDDVELNTLTKNFTNQKLSF
AQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKEHYKIFNFFKT
VLSAYRNNVAKNNPFE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcttgcaaaaatcgtttttagctcgttggttgcgtttggagttttgtcggctaatgtg
gagcagtttggttcatttttcaacgagataaaaaaagaacaagaagaggtggctgcaaaa
gaagacgctcttaaggcccgcaaaaagctcttaaataatacgcatgatttcttagaagac
ttgatttttagaaaacaaaaaatcaaagagcttgtggatcatagagctaaagttctttca
gatttagaaaacaaatacaaaaaagaaaaagaggctctagagaaagagacaagaggtaag
atccttgctgctaagtcaaaggcttatggggatctagagcaagccttaaaagataactct
ctctataaaaaacttcttcctaacccttatgcctatgttttaaaccaagaaacattcacc
aaagaagataaggagcgtttgagttattactacccacaagtcaaaaacagcaacattttc
aaaaaaactaccgctaccactaaagataaggctcaggctttgcttcaaatgggtgtgttt
tctttagatgaagaacaaaacaaaaaagcgagccgattagctttatcttacaagcaagcg
attgaagaatattccaataacatttctaatttattgagcagaaaagaattggataatata
gattattacttacagcttgaaagaaacaagtttgactccaaagcaaaagatatcgctcaa
aaagctactaacgcgcttatttttaactcggaacgcttggcgtttagcatggcgattgat
aagatcaatgagaaatacttaaggggctatgaggctttttctaacttgttgaaaaatgtc
aaagatgatgtggaattgaacactctgactaaaaactttaccaatcaaaaattgagtttc
gctcaaaaacaaaaattgtgtttgttggttttagacagcttcaattttgatacccaatcc
aaaaaatctatattaaaaaagactaatgaatacaatattttcgtagatagcgatcctatg
atgagcgacaaaacaactatgcaaaaagaacactacaagatatttaatttcttcaaaaca
gtgctttctgcataccgaaacaatgttgccaagaataatccctttgaatag

DBGET integrated database retrieval system