KEGG   Helicobacter pylori PeCan4: HPPC_02660
Entry
HPPC_02660        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein (cagN, cag17)
  KO
K12102  cag pathogenicity island protein 17
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02660
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02660
SSDB
Motif
Pfam: UPF0231 MetOD2 PEHE DUF3533
Other DBs
NCBI-ProteinID: ADO06770
UniProt: E1Q627
Position
524450..525361
AA seq 303 aa
MKSIFKKLGSVALYFLVIYGGLNAINTALLPSEYKKLVALGFKKLYQRHDDKEVTEEEKK
FATNALREKLRNDRARAEQIQKNIEAFEKKNNSSIQKKATKHKGLQELNETNANPLNGNP
NSNSSTETKSNKDDNFDEMINKVNEAFVKPATPLVPNEWRTPEIETIINECIISSNDYDG
LRKCLIKGIKDQKILAPLLEKIQEIETENNKFSRQHLSGLKLALNNSNNRTFLIASCAIC
EKRKKEMEQENNYQDTTNTSEFGATDTKENEAKDATFSNNRSKSELPNSVINQIEQSIAH
GKK
NT seq 912 nt   +upstreamnt  +downstreamnt
ttgaaaagtatcttcaaaaaactaggttctgtcgctctttattttttagttatttatggg
ggcttaaacgctatcaatacagcattattaccgagtgaatacaaaaaattagtggcttta
ggctttaaaaaactctatcaaagacatgacgacaaagaagttacagaagaggaaaaaaaa
ttcgccactaacgctttgagagaaaaattacgaaatgatagggcgagagcggagcaaatt
caaaaaaatattgaagcgtttgaaaaaaagaacaactcttctattcaaaaaaaagcgact
aagcacaaaggattacaagaattaaacgaaactaacgctaaccctttgaatggcaatcct
aatagtaattcttccactgaaaccaaatctaataaagatgataactttgatgagatgatc
aataaggtgaatgaagcttttgtgaaacctgctactccgcttgtgcctaatgagtggaga
acgcctgaaattgaaaccattatcaatgagtgcattatttcaagcaacgattacgatggg
ttaaggaagtgtttgatcaaaggcatcaaggatcaaaaaattcttgcccccttattagaa
aaaattcaagaaatagagacagaaaataacaagttttctagacaacacttgagtggttta
aagctcgctcttaataacagcaacaatagaacctttcttatagcttcgtgtgctatttgt
gagaagagaaaaaaagaaatggagcaagaaaataactaccaagatactacaaatacaagc
gagtttggagctactgatacaaaagaaaatgaagcaaaagatgcaacattctcaaacaat
cgctctaaatccgaactgcccaatagcgtcattaatcaaatagaacaaagcatcgctcat
ggaaaaaaatag

DBGET integrated database retrieval system