KEGG   Helicobacter pylori PeCan4: HPPC_02670Help
Entry
HPPC_02670        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein I
  KO
K12104  cag pathogenicity island protein 19
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02670
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bin3
Motif
Other DBs
NCBI-ProteinID: ADO06772
UniProt: E1Q629
Position
complement(526152..527291)
Genome map
AA seq 379 aa AA seqDB search
MKYFLSIFSFLTFLFLNGGEAVITLEPALKAIQADAQAKQKTAQAELKAIEAQSNAKEKA
IQAQIEGELRTQLATMSAMLKGANGVINGVNGMTGGFFAGSDILLGVMEGYSSALSALGG
NVKMIVEKQKINTQTEIQNMQIALQKNNEIIKLKMNQQNALLEALKNSFEPSVTLKTQME
MLSQALGSSSDNAQYIAYNTIGIKAFEETLKGFETWLKTAMQKATLIDYNSLTGQALFQS
AIYAPALSFFSSMGAPFGIIETFTLAPTKCPYLDGLKISACLMEQVIQNYRMIVALIQNK
LSDADFQNIAYLNGINGEIKTLKGSVDLNALIEVAILNAENHLNYIENLEKKADLWEEQL
KLERETTARNIASSKVIVK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatattttttaagcatattttctttcttaacttttttgtttctgaatggtggagag
gcagtaataacgcttgaacctgccttaaaagccattcaagcggatgcacaagccaaacaa
aaaaccgctcaagccgaattaaaagccatagaggctcaatctaatgccaaagaaaaagcc
attcaagcgcaaatagagggagaattgaggactcagcttgcaactatgagcgctatgtta
aaaggggctaatggcgttattaatggtgtcaatggcatgacaggggggttttttgcaggt
tcagacatcttgcttggcgtcatggaagggtattcaagcgcgcttagcgcattggggggg
aatgtcaaaatgatcgtggaaaaacaaaaaattaacacccaaacagaaatccaaaacatg
caaattgcgctccaaaaaaataacgaaataatcaagctcaaaatgaaccagcaaaacgct
ctcttagaagcgttaaaaaacagctttgaaccgagcgttactctaaaaacacaaatggaa
atgctttctcaagctctaggaagttcttctgacaacgctcaatacatcgcttacaatacg
attggtatcaaggcgtttgaagaaaccttaaaaggttttgaaacatggttgaaaacagct
atgcaaaaagcgacccttattgattataattccctaacaggtcaggctttgtttcaaagc
gccatctacgcgcctgctcttagttttttttcaagcatgggcgcaccatttggaatcatt
gaaacattcactctagcacccacaaaatgcccctatcttgatgggctaaaaatttcagca
tgccttatggaacaggttattcagaattacagaatgattgtagcccttattcaaaataaa
ctgagtgatgcagattttcaaaatatcgcttatttgaatgggatcaatggagaaatcaaa
accttaaaaggatcagtagatttgaacgcactcatagaagttgctatcttaaacgcagaa
aatcatttaaactatatagagaatcttgaaaaaaaagccgacctttgggaagaacaactg
aaattagaaagagaaacgacagcaagaaacattgctagctctaaagttattgtcaaatga

DBGET integrated database retrieval system