KEGG   Helicobacter pylori PeCan4: HPPC_02705
Entry
HPPC_02705        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein C
  KO
K12110  cag pathogenicity island protein 25
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02705
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02705
SSDB
Motif
Pfam: T4SS_CagC
Other DBs
NCBI-ProteinID: ADO06779
UniProt: E1Q636
Position
complement(533307..533654)
AA seq 115 aa
MKFFTRITDSYKKVVVTLGLVMTTNPLMAVTSPATGVTETKTLVIQIISVLAIVGGCALG
VKGIADIWKISDDIKRGQATVFAYAQPIAMLAVAGGIIFLSTKFGFNIDEGGGAS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaattttttacaagaatcactgacagctacaagaaagttgtagtaactttagggcta
gtgatgacaaccaatcctttaatggcggtcaccagtcctgcaacaggcgttactgagact
aaaactttggttattcagatcatttctgttctagcgatcgtaggtggttgcgctttaggg
gtcaaaggcatagcagatatttggaaaatctctgatgacatcaaaagaggtcaggcgact
gtttttgcttacgcgcaacccatagctatgttagcggtggcaggcggtattatctttttg
agcactaagtttggcttcaatattgacgagggtggaggagctagctaa

DBGET integrated database retrieval system