KEGG   Helicobacter pylori PeCan4: HPPC_03330Help
Entry
HPPC_03330        CDS       T01322                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00071  Fatty acid degradation
hpc00072  Synthesis and degradation of ketone bodies
hpc00280  Valine, leucine and isoleucine degradation
hpc00310  Lysine degradation
hpc00362  Benzoate degradation
hpc00380  Tryptophan metabolism
hpc00620  Pyruvate metabolism
hpc00630  Glyoxylate and dicarboxylate metabolism
hpc00640  Propanoate metabolism
hpc00650  Butanoate metabolism
hpc00900  Terpenoid backbone biosynthesis
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
hpc01200  Carbon metabolism
hpc01212  Fatty acid metabolism
hpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPPC_03330
   00630 Glyoxylate and dicarboxylate metabolism
    HPPC_03330
   00640 Propanoate metabolism
    HPPC_03330
   00650 Butanoate metabolism
    HPPC_03330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPPC_03330
   00072 Synthesis and degradation of ketone bodies
    HPPC_03330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPPC_03330
   00310 Lysine degradation
    HPPC_03330
   00380 Tryptophan metabolism
    HPPC_03330
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPC_03330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPPC_03330
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPPC_03330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpc04147]
    HPPC_03330
Enzymes [BR:hpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPPC_03330
Exosome [BR:hpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPC_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADO06898
UniProt: E1Q6F5
Position
complement(666767..667942)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGTVVLKDALNASGLEPSDVDSVILGNVLSAG
LGQNIARQIQLDAEIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMICDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAVQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcactgtcgtgcttaaagacgctttgaatgcg
agcggtcttgagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccaggcagatccaactggatgctgaaatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagtgca
gccccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcaaacatgata
gactccatgatctgtgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcagta
acggcaggaaattcatcagggatcaatgatggcgcaagcattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgccgtg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggtgcgagcggtgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system