KEGG   Helicobacter pylori PeCan4: HPPC_03680Help
Entry
HPPC_03680        CDS       T01322                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
hpc  Helicobacter pylori PeCan4
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpc03016]
    HPPC_03680
Enzymes [BR:hpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     HPPC_03680
Transfer RNA biogenesis [BR:hpc03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    HPPC_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ADO06966
UniProt: E1Q6M3
Position
complement(741906..742922)
Genome map
AA seq 338 aa AA seqDB search
MTARDFKNYLEPLREGKNLLGFSGGLDSTCLFHLLVGENIAFDIALVDYNTQKQRLEIIQ
HAQKLAKTHHKKCYIHYAPKIACNFEMQARKIRYDFFETLIKEHSYKHLILAHHLNDRLE
WFLMQLSKGAGLNTLLSFQAYEKRGFYAIVRPLLYTPKDTLKTLAKDLKFFEDSSNSSLK
FKRNFFRKHYANALMQHYSKGIIQSFKFLDQEKERLYPLIPVSQMHGITFFKYSQNALFM
VDKILKQKGYVLSFSQKEEIKRHFFSLEIAQKFIIESDKECVFIAFKPPKTLSMPKDFKD
RARRLNIPKRLRPVLYAEFLKQPTHDFLTRFKQSLMDL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgacagcacgagattttaaaaattatttagagcctttaagagaggggaaaaatttattg
ggtttttcaggtgggttggattccacttgtttgtttcatcttttagttggagaaaacatc
gcttttgacatcgctttagtggattataacacgcaaaaacaacgccttgaaatcatccaa
cacgctcaaaaactcgcaaaaacgcaccataaaaaatgctacatccattacgccccaaaa
atcgcatgcaattttgaaatgcaagcgagaaagatccgttatgatttttttgaaacccta
atcaaagagcattcttacaagcatttgattttagcgcaccatttgaatgacaggctggaa
tggtttttgatgcaattgagtaaaggtgctggattaaacacgcttttaagctttcaagct
tatgaaaaaagagggttttatgcgatcgttcgccccttgctctacacccctaaagacacc
cttaaaacgctcgctaaagatttgaaattttttgaagatagttctaattcttctttaaaa
ttcaaacgcaattttttcaggaaacattacgctaacgccttgatgcaacattattctaag
ggcattatccaaagttttaaatttttggatcaagaaaaagagcggctttatcctttgatt
cccgtttcacaaatgcatgggatcactttttttaagtattcgcaaaatgcgctttttatg
gtggataaaatcttaaagcaaaaggggtatgtgttgagcttttctcaaaaagaagaaatc
aaacgccatttttttagcctagaaatcgctcaaaaattcatcattgaaagcgacaaagag
tgtgtatttatcgcttttaaacccccaaaaactttgagcatgccaaaggattttaaagac
agggccaggcggttgaatatccccaaacgcttacggcctgttttatacgcagagttttta
aaacagccaacgcatgattttttaacccgtttcaaacagagtttaatggatctataa

DBGET integrated database retrieval system