KEGG   Helicobacter pylori PeCan4: HPPC_06270Help
Entry
HPPC_06270        CDS       T01322                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00010  Glycolysis / Gluconeogenesis
hpc00030  Pentose phosphate pathway
hpc00051  Fructose and mannose metabolism
hpc00052  Galactose metabolism
hpc00230  Purine metabolism
hpc00500  Starch and sucrose metabolism
hpc00520  Amino sugar and nucleotide sugar metabolism
hpc00521  Streptomycin biosynthesis
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_06270
   00030 Pentose phosphate pathway
    HPPC_06270
   00051 Fructose and mannose metabolism
    HPPC_06270
   00052 Galactose metabolism
    HPPC_06270
   00500 Starch and sucrose metabolism
    HPPC_06270
   00520 Amino sugar and nucleotide sugar metabolism
    HPPC_06270
  Nucleotide metabolism
   00230 Purine metabolism
    HPPC_06270
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPC_06270
Enzymes [BR:hpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPPC_06270
    5.4.2.8  phosphomannomutase
     HPPC_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADO07462
UniProt: E1Q3N3
Position
1272917..1274293
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALEAYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPNNFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagggaatacgatattagaggcatttaccccaccactttagac
gaaaagagcgcctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggctacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaatatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaatattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcaatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaatctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaaataat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagagcactactcaatttgctagagaaataa

DBGET integrated database retrieval system