KEGG   Helicobacter pylori 51: KHP_0632Help
Entry
KHP_0632          CDS       T02082                                 

Gene name
fadA
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpd  Helicobacter pylori 51
Pathway
hpd00071  Fatty acid degradation
hpd00072  Synthesis and degradation of ketone bodies
hpd00280  Valine, leucine and isoleucine degradation
hpd00310  Lysine degradation
hpd00362  Benzoate degradation
hpd00380  Tryptophan metabolism
hpd00620  Pyruvate metabolism
hpd00630  Glyoxylate and dicarboxylate metabolism
hpd00640  Propanoate metabolism
hpd00650  Butanoate metabolism
hpd00900  Terpenoid backbone biosynthesis
hpd01100  Metabolic pathways
hpd01110  Biosynthesis of secondary metabolites
hpd01120  Microbial metabolism in diverse environments
hpd01130  Biosynthesis of antibiotics
hpd01200  Carbon metabolism
hpd01212  Fatty acid metabolism
hpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KHP_0632 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    KHP_0632 (fadA)
   00640 Propanoate metabolism
    KHP_0632 (fadA)
   00650 Butanoate metabolism
    KHP_0632 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KHP_0632 (fadA)
   00072 Synthesis and degradation of ketone bodies
    KHP_0632 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KHP_0632 (fadA)
   00310 Lysine degradation
    KHP_0632 (fadA)
   00380 Tryptophan metabolism
    KHP_0632 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KHP_0632 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KHP_0632 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KHP_0632 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpd04147]
    KHP_0632 (fadA)
Enzymes [BR:hpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KHP_0632 (fadA)
Exosome [BR:hpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KHP_0632 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACX97839
UniProt: D0ISE6
Position
complement(663912..665087)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGTVVLKDALNASALKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDTFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcactgtcgtgcttaaagacgctttgaatgcg
agcgctcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatattgccagacagatccaactggacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgtgatgaggtggtggtgtgcggtggcgtggagaatatgagtgca
gcaccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgccaacatgata
gactccatgatccatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatactttcgcgctc
caatcgcaactcaaagcaagagctgccattaatgcagggaaattccaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcact
caaaaagcgcaaaaattgggcttaaaaaccatggcgactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggattttagtaacttta
ttgcatgaaatgaaaagaagcgctcatagcgtgggttgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system