KEGG   Helicobacter pylori 51: KHP_1001Help
Entry
KHP_1001          CDS       T02082                                 

Gene name
g6pD
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hpd  Helicobacter pylori 51
Pathway
hpd00030  Pentose phosphate pathway
hpd00480  Glutathione metabolism
hpd01100  Metabolic pathways
hpd01110  Biosynthesis of secondary metabolites
hpd01120  Microbial metabolism in diverse environments
hpd01130  Biosynthesis of antibiotics
hpd01200  Carbon metabolism
Module
hpd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KHP_1001 (g6pD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KHP_1001 (g6pD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpd04147]
    KHP_1001 (g6pD)
Enzymes [BR:hpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KHP_1001 (g6pD)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KHP_1001 (g6pD)
Exosome [BR:hpd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KHP_1001 (g6pD)
  Exosomal proteins of colorectal cancer cells
   KHP_1001 (g6pD)
  Exosomal proteins of bladder cancer cells
   KHP_1001 (g6pD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACX98198
UniProt: D0ITF5
Position
1109176..1110453
Genome map
AA seq 425 aa AA seqDB search
MLDFNLVLFGATGDLAMRKLFVSLYEIYTHYGFKKDSKIIASGRKELSNEEFLVLLCEKT
QLHSREKGEEFLAHISYFCVRLDNPKDFEELSKIATKNKLLIFYFSISPSFFATTAQHLA
KNALNHANTRLILEKPLGHDLKTCKEIFQSISAFFKEEQIFRIDHYLGKKGVQNILELRL
NNPILNILWDQISAVEICVYETLGVEERGEFYDKIGALRDMVQNHLLQVLSLIATDLPND
LKDLRKEKIKVLKTLQSPKDFKKQVIRAQYQGYRDENKVHKESQTETFVAIKAFLDTPKF
KGVPFYLKHAKKMPHNQASVKIHFNAVNTLEFFLSQDKITLTLQDHQNPLILETHHKQEF
LQPYAKLLYDAIQNNHNNFAHQLELEASWVFIDTLIEGFMNNATPLHSYEGHHLNESEFL
KPLYQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttagattttaatttggttctttttggcgcaactggggatttagccatgcggaagctc
tttgtttcgctctatgaaatttatacccattatggttttaaaaaagattctaaaattatc
gcatcagggcgcaaggagctatccaatgaagaatttttagtgctcctttgcgaaaagaca
caactgcattcaagagaaaagggtgaggaatttttagcccatatcagttatttttgcgtt
cgtttggataaccctaaagactttgaagaattgagtaaaatcgctacaaaaaataaactc
ttgattttctacttttctatctcccctagtttttttgcaacgaccgcccaacatctcgct
aaaaacgcgctcaatcacgccaatacgcgcttgattttagaaaagcctttagggcatgat
ttaaagacttgtaaagagattttccaaagcattagcgctttttttaaagaagaacaaatc
tttagaatcgatcattatttagggaaaaagggcgttcaaaatatccttgaattgcgccta
aataaccctatcttaaacattttatgggatcaaatcagtgcggttgaaatctgcgtgtat
gagactttaggggtggaagaaaggggcgaattttacgataaaatcggggctttaagggat
atggttcaaaaccatctcttgcaagttttatcccttatcgctacagatttacccaacgat
ttaaaggatttgaggaaagaaaaaatcaaagttttaaaaaccttacaatcccctaaagac
tttaaaaaacaagtgatccgcgcccagtatcaaggctatagagatgaaaataaggtccat
aaagagagccagacagaaacttttgtcgctattaaagcctttttggatacacctaaattt
aaaggcgtgcctttctaccttaaacacgctaaaaaaatgccccacaaccaagcgagcgtg
aaaatccattttaatgcagtcaatacgctagaatttttcctctctcaagacaaaatcacc
ctcaccctacaagatcatcaaaacccccttattttagaaacccatcacaaacaagaattt
ttacagccctacgctaaattgctctatgatgcgatacaaaataaccacaataatttcgcc
caccagttggaattggaagcgtcatgggtttttattgacacactcatagaaggttttatg
aataacgccacgcccttacattcctatgaaggccaccatctaaacgaatccgaattttta
aaaccactctatcaataa

DBGET integrated database retrieval system