KEGG   Helicobacter pylori 51: KHP_1390Help
Entry
KHP_1390          CDS       T02082                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpd  Helicobacter pylori 51
Pathway
hpd00220  Arginine biosynthesis
hpd00330  Arginine and proline metabolism
hpd01100  Metabolic pathways
hpd01110  Biosynthesis of secondary metabolites
hpd01130  Biosynthesis of antibiotics
hpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KHP_1390 (rocF)
   00330 Arginine and proline metabolism
    KHP_1390 (rocF)
Enzymes [BR:hpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KHP_1390 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACX98577
UniProt: D0IUI4
Structure
PDB: 

Position
complement(1522281..1523249)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLRAVEVTEYNPTVSAKHNNEEEKQVLE
ILDLIINSCKIKNKKPSFTMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcattcaagagcggtgtgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttaattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagagaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagtgaaagagatgtgattaaggaattacaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagttgaag
caattactgggcttgcttttagaaagctttaaagacagattaagagccgttgaggtaacc
gaatacaaccccacggtgagcgccaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaaaacaagaagccatcttttacaatg
agtcgctga

DBGET integrated database retrieval system